PLA2G1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLA2G1B Antibody [NBP2-32569] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PLA2G1B Antibody [NBP2-32569] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2G1B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLA2G1B Protein (NBP2-32569PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2G1B Antibody

  • Group IB phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 1B
  • phospholipase A2
  • phospholipase A2, group IB (pancreas)
  • PLA2
  • PLA2A
  • PLA2AMGC119834
  • PLA2EC 3.1.1.4
  • PLA2G1B
  • PPLA2
  • PPLA2MGC119835

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLA2G1B Antibody (NBP2-32569) (0)

There are no publications for PLA2G1B Antibody (NBP2-32569).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G1B Antibody (NBP2-32569) (0)

There are no reviews for PLA2G1B Antibody (NBP2-32569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLA2G1B Antibody (NBP2-32569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLA2G1B Products

Bioinformatics Tool for PLA2G1B Antibody (NBP2-32569)

Discover related pathways, diseases and genes to PLA2G1B Antibody (NBP2-32569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G1B Antibody (NBP2-32569)

Discover more about diseases related to PLA2G1B Antibody (NBP2-32569).
 

Pathways for PLA2G1B Antibody (NBP2-32569)

View related products by pathway.

PTMs for PLA2G1B Antibody (NBP2-32569)

Learn more about PTMs related to PLA2G1B Antibody (NBP2-32569).
 

Research Areas for PLA2G1B Antibody (NBP2-32569)

Find related products by research area.

Blogs on PLA2G1B

There are no specific blogs for PLA2G1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G1B
Entrez