Peroxiredoxin 1 Antibody (4B11-D10)

Images

 
Western Blot: Peroxiredoxin 1 Antibody (4B11-D10) [H00005052-M01] - PRDX1 monoclonal antibody (M01), clone 4B11-D10 Analysis of PRDX1 expression in HeLa.
ELISA: Peroxiredoxin 1 Antibody (4B11-D10) [H00005052-M01] - Detection limit for recombinant GST tagged PRDX1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
4B11-D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Peroxiredoxin 1 Antibody (4B11-D10) Summary

Immunogen
PRDX1 (AAH07063, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFHPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Localization
Cytoplasmic
Specificity
PRDX1 - peroxiredoxin 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRDX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.
Publications
Read Publications using H00005052-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peroxiredoxin 1 Antibody (4B11-D10)

  • EC 1.11.1
  • EC 1.11.1.15
  • Natural killer cell-enhancing factor A
  • natural killer-enhancing factor A
  • NKEFA
  • NKEF-A
  • PAG
  • PAGAMSP23
  • PAGB
  • Peroxiredoxin 1
  • peroxiredoxin-1
  • PRDX1
  • proliferation-associated gene A
  • Proliferation-associated gene protein
  • PRX1
  • PRXI
  • TDPX2
  • Thioredoxin peroxidase 2
  • Thioredoxin-dependent peroxide reductase 2

Background

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-56414
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00051450-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-67043
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-06067
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00005052-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Peroxiredoxin 1 Antibody (H00005052-M01)(3)

Reviews for Peroxiredoxin 1 Antibody (H00005052-M01) (0)

There are no reviews for Peroxiredoxin 1 Antibody (H00005052-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peroxiredoxin 1 Antibody (H00005052-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peroxiredoxin 1 Products

Bioinformatics Tool for Peroxiredoxin 1 Antibody (H00005052-M01)

Discover related pathways, diseases and genes to Peroxiredoxin 1 Antibody (H00005052-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 1 Antibody (H00005052-M01)

Discover more about diseases related to Peroxiredoxin 1 Antibody (H00005052-M01).
 

Pathways for Peroxiredoxin 1 Antibody (H00005052-M01)

View related products by pathway.

PTMs for Peroxiredoxin 1 Antibody (H00005052-M01)

Learn more about PTMs related to Peroxiredoxin 1 Antibody (H00005052-M01).
 

Research Areas for Peroxiredoxin 1 Antibody (H00005052-M01)

Find related products by research area.

Blogs on Peroxiredoxin 1

There are no specific blogs for Peroxiredoxin 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 1 Antibody (4B11-D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX1
Entrez
OMIM
Uniprot