Peptidase Inhibitor 16/PI16 Antibody

Immunohistochemistry-Paraffin: Peptidase Inhibitor 16/PI16 Antibody [NBP2-69019] - Staining of human retina shows moderate positivity in nerve fiber layer.

Product Discontinued

Peptidase Inhibitor 16/PI16 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PI16
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Peptidase Inhibitor 16/PI16 Antibody

• CRISP9
• CRISP-9
• Cysteine-rich secretory protein 9
• dJ90K10.5
• DKFZp586B1817
• MGC45378
• microseminoprotein, beta-binding protein
• MSMBBP
• Peptidase Inhibitor 16
• PI16
• PI-16
• protease inhibitor 16
• PSP94-binding protein
• PSPBP

Background

PI16 also known as Peptidase Inhibitor 16, has 2 isoforms, a 463 amino acid long isoform that is 49 kDa and a short 270 amino acid isoform that is 30 kDa; expressed in prostate, testis, ovary and intestine, concentrates in prostate cancer patient's sera; and acts as putative serine protease inhibitor. Disease research is currently being studied with relation to PI16 and prostate adenocarcinoma, adenocarcinoma, prostatitis, and prostate cancer. Little is currently known about PI16 protein interactions with other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PI16