Pepsinogen C/PGC/Progastricsin Antibody

Images

 
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression ...read more
Immunocytochemistry/ Immunofluorescence: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pepsinogen C/PGC/Progastricsin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pepsinogen C/PGC/Progastricsin Recombinant Protein Antigen (NBP1-91012PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pepsinogen C/PGC/Progastricsin Antibody

  • EC 3.4.23
  • EC 3.4.23.3
  • FLJ99563
  • Gastricsin
  • PEPC
  • pepsin C
  • Pepsinogen C
  • pepsinogen group II
  • PGC
  • PGII
  • preprogastricsin
  • progastricsin (pepsinogen C)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
8457-AS
Species: Hu
NB100-62239
Species: Hu
Applications: ELISA, IHC-P, RIA
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012) (0)

There are no publications for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012) (0)

There are no reviews for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pepsinogen C/PGC/Progastricsin Products

Bioinformatics Tool for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012)

Discover related pathways, diseases and genes to Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012)

Discover more about diseases related to Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012).
 

Pathways for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012)

View related products by pathway.

PTMs for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012)

Learn more about PTMs related to Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91012).

Blogs on Pepsinogen C/PGC/Progastricsin

There are no specific blogs for Pepsinogen C/PGC/Progastricsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pepsinogen C/PGC/Progastricsin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGC