PELP1 Antibody (4F7)

Product Discontinued

PELP1 Antibody (4F7) Summary

• Immunogen: PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PELP1
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PELP1 Antibody (4F7)

• HMX3
• MNARmodulator of nongenomic activity of estrogen receptor
• Modulator of non-genomic activity of estrogen receptor
• P160
• proline and glutamic acid rich nuclear protein
• proline, glutamate and leucine rich protein 1
• proline, glutamic acid and leucine rich protein 1
• proline-, glutamic acid- and leucine-rich protein 1
• proline-, glutamic acid-, leucine-rich protein 1
• Transcription factor HMX3

Background

PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PELP1
• Entrez:
  • 27043(Human)
• OMIM:
  • 609455(Human)
• Uniprot:
  • AAW80659.1(Human)