PELO Antibody (2C2) - Azide and BSA Free

Western Blot: PELO Antibody (2C2) [H00053918-M03] - Analysis of PELO expression in transfected 293T cell line by PELO monoclonal antibody (M03), clone 2C2. Lane 1: PELO transfected lysate (Predicted MW: 43.4 KDa). Lane 2: Non-transfected lysate.

Immunoprecipitation: PELO Antibody (2C2) [H00053918-M03] - Analysis of PELO transfected lysate using anti-PELO monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PELO monoclonal antibody.

Sandwich ELISA: PELO Antibody (2C2) [H00053918-M03] - Detection limit for recombinant GST tagged PELO is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 2C2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PELO Antibody (2C2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PELO Antibody (2C2) - Azide and BSA Free (H00053918-M03) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PELO (NP_057030.3, 291 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
• Specificity: Reacts with pelota homolog (Drosophila).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PELO
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PELO Antibody (2C2) - Azide and BSA Free

• EC 3.1
• pelota (Drosophila) homolog
• pelota homolog (Drosophila)
• PRO1770
• protein pelota homolog

Background

This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PELO
• Entrez:
  • 53918(Human)
• Uniprot:
  • NP_057030(Human)