Pea3 Recombinant Protein Antigen

Product Discontinued

Pea3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETV4.
  
  

  Source: E. coli

  Amino Acid Sequence: YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ETV4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87960.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pea3 Recombinant Protein Antigen

• Adenovirus E1A enhancer-binding protein
• E1A-FE1A enhancer binding protein
• E1AFETS translocation variant 4
• ets variant 4
• ets variant gene 4 (E1A enhancer binding protein, E1AF)
• ets variant gene 4 (E1A enhancer-binding protein, E1AF)
• EWS protein/E1A enhancer binding protein chimera
• PEA3
• PEAS3
• Polyomavirus enhancer activator 3 homolog
• polyomavirus enhancer activator-3
• Protein PEA3

Background

Pea3, also known as ETS translocation variant 4, is an approximately 54 kDa, 484 amino acid protein, which is involved in transcriptional activation of adenovirus E1A gene, and is regulated by ERBB2, STK11, PLAG1, CTNNB1. Studies about the Pea3 protein are being done on diseases such as ovaria, pancreatic, gastric, breast, and prostate cancers. As well as peripheral primitive neuroectodermal tumors, carcinoma, adenoma, ewings sarcoma, squamous cell carcinoma, and oral cancers. The Pea3 protein has shown interaction with Taf7, EP300, SRF, HOXD4, STK11, and involvement in the ErbB2-ErbB3 Heterodimer pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ETV4