Pea3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pea3 Antibody [NBP1-87960] - Staining of human cell line U-251 MG shows localization to nucleoli. Antibody staining is shown in green. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pea3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGV
Specificity
Specificity of human Pea3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ETV4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publications using NBP1-87960.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22971420)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pea3 Antibody

  • Adenovirus E1A enhancer-binding protein
  • E1A-FE1A enhancer binding protein
  • E1AFETS translocation variant 4
  • ets variant 4
  • ets variant gene 4 (E1A enhancer binding protein, E1AF)
  • ets variant gene 4 (E1A enhancer-binding protein, E1AF)
  • EWS protein/E1A enhancer binding protein chimera
  • PEA3
  • PEAS3
  • Polyomavirus enhancer activator 3 homolog
  • polyomavirus enhancer activator-3
  • Protein PEA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-57731
Species: Hu
Applications: WB, ICC/IF
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7284
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-80513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Pea3 Antibody (NBP1-87960)(2)

Reviews for Pea3 Antibody (NBP1-87960) (0)

There are no reviews for Pea3 Antibody (NBP1-87960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pea3 Antibody (NBP1-87960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pea3 Products

Bioinformatics Tool for Pea3 Antibody (NBP1-87960)

Discover related pathways, diseases and genes to Pea3 Antibody (NBP1-87960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pea3 Antibody (NBP1-87960)

Discover more about diseases related to Pea3 Antibody (NBP1-87960).
 

Pathways for Pea3 Antibody (NBP1-87960)

View related products by pathway.

PTMs for Pea3 Antibody (NBP1-87960)

Learn more about PTMs related to Pea3 Antibody (NBP1-87960).
 

Research Areas for Pea3 Antibody (NBP1-87960)

Find related products by research area.

Blogs on Pea3

There are no specific blogs for Pea3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pea3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ETV4
Novus 100% Guarantee