PDZRN3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PDZRN3 Antibody [NBP2-55802] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDZRN3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
Specificity
Specificity of human PDZRN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZRN3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDZRN3 Recombinant Protein Antigen (NBP2-55802PEP)
Publications
Read Publication using NBP2-55802.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PDZRN3 Antibody

  • E3 ubiquitin-protein ligase PDZRN3
  • EC 6.3.2.-
  • Ligand of Numb protein X 3
  • likely ortholog of mouse semaF cytoplasmic domain associated protein 3
  • LNX3KIAA1095SEMACAP3
  • PDZ domain containing ring finger 3
  • PDZ domain-containing RING finger protein 3
  • Protein SEMACAP3
  • Semaphorin cytoplasmic domain-associated protein 3
  • SEMCAP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19762
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80518
Species: Hu
Applications: WB
NBP1-81069
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-88136
Species: Hu
Applications: WB (-), IP
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-47935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
NBP2-55802
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PDZRN3 Antibody (NBP2-55802)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for PDZRN3 Antibody (NBP2-55802) (0)

There are no reviews for PDZRN3 Antibody (NBP2-55802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDZRN3 Antibody (NBP2-55802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDZRN3 Products

Bioinformatics Tool for PDZRN3 Antibody (NBP2-55802)

Discover related pathways, diseases and genes to PDZRN3 Antibody (NBP2-55802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZRN3 Antibody (NBP2-55802)

Discover more about diseases related to PDZRN3 Antibody (NBP2-55802).
 

Pathways for PDZRN3 Antibody (NBP2-55802)

View related products by pathway.

PTMs for PDZRN3 Antibody (NBP2-55802)

Learn more about PTMs related to PDZRN3 Antibody (NBP2-55802).
 

Research Areas for PDZRN3 Antibody (NBP2-55802)

Find related products by research area.

Blogs on PDZRN3

There are no specific blogs for PDZRN3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDZRN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZRN3