Home » PDZRN3 » PDZRN3 Antibodies » PDZRN3 Antibody

PDZRN3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PDZRN3 Antibody [NBP2-55802] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PDZRN3 Antibody [NBP2-55802] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDZRN3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
Specificity
Specificity of human PDZRN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZRN3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDZRN3 Recombinant Protein Antigen (NBP2-55802PEP)
Publications
Read Publication using NBP2-55802.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PDZRN3 Antibody

  • E3 ubiquitin-protein ligase PDZRN3
  • EC 6.3.2.-
  • Ligand of Numb protein X 3
  • likely ortholog of mouse semaF cytoplasmic domain associated protein 3
  • LNX3KIAA1095SEMACAP3
  • PDZ domain containing ring finger 3
  • PDZ domain-containing RING finger protein 3
  • Protein SEMACAP3
  • Semaphorin cytoplasmic domain-associated protein 3
  • SEMCAP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PDZRN4 Antibody
NBP2-19762
Western Blot: PDZRN4 Antibody [NBP2-19762] - Sample (30 ug of whole cell lysate) A: Hep G2 7. 5% SDS PAGE gel, diluted at 1:3000.
Immunohistochemistry-Paraffin: PDZRN4 Antibody [NBP2-19762] - Immunohistochemical analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
Lnx1 Antibody
NBP1-80518
Western Blot: Lnx1 Antibody [NBP1-80518] - Host: Rabbit. Target Name: LNX1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: Lnx1 Antibody [NBP1-80518] - Transfected 293T cell lysate, concentration 1.25ug/ml.
Species: Hu
Applications: WB
LNX2 Antibody
NBP1-81069
Immunocytochemistry/Immunofluorescence: LNX2 Antibody [NBP1-81069] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: LNX2 Antibody [NBP1-81069] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
MUL1 Antibody
(5H6.2D5)
NBP2-31361
Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a transverse section of normal skeletal muscle from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The myocytes and blood capillaries depicted strong staining whereas the nuclei were found negative for MUL1.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.
Species: Hu
Applications: WB, IHC, IHC-P
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
Numb Antibody
NB500-178
Western Blot: NUMB Antibody [NB500-178] - Detection of NUMB isoforms 1 and 2 in A431 whole cell lysate (20 ug) using 0.5 ug/ml of NB500-178. ECL detection: 30 seconds.
Immunocytochemistry/Immunofluorescence: NUMB Antibody [NB500-178] - The NUMB antibody was tested in HepG2 cells at a 1:500 dilution against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Simple Western: Numb Antibody [NB500-178] - Simple Western lane view shows a specific band for NUMB in 0.5 mg/ml of A431 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(4 Publications)
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
CXADR Antibody
NBP1-88192
Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining in human rectum and skeletal muscle tissues using anti-CXADR antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NUMBL Antibody
NB100-88136
Immunoprecipitation: NUMBL Antibody [NB100-88136] - Detection of Human NUMBL1 by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-NUMBL1 antibody Nb100-88136 used for IP at 3 mcg/mg lysate. NUMBL1 was also immunoprecipitated by rabbit anti-NUMBL1 antibody NB100-88137, which recognizes a downstream epitope. Detection: Chemiluminescence with an exposure time of 3 seconds.
Species: Hu
Applications: WB (-), IP
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Immunocytochemistry/Immunofluorescence: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Analysis of bovine corneal epithelium (CE) limbus tissue.
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Normal biopsies of deparaffinized Human kidney tissue.
(20 Publications)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
SPG7 Antibody
(OTI1C1)
NBP2-01860
Western Blot: SPG7 Antibody (OTI1C1) [NBP2-01860] - Analysis of extracts (35 ug) from 9 different cell lines by using anti-SPG7 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SPG7 Antibody (1C1) [NBP2-01860] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SPG7.
Flow Cytometry: SPG7 Antibody (1C1) [NBP2-01860] - Analysis of Jurkat cells, using anti-SPG7 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
Arrestin 3 Antibody
NBP1-37003
Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP1-37003] - Negative Control showing staining of paraffin embedded Human Retina, with no primary antibody.
Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP1-37003] - Staining of paraffin embedded Human Retina. Antibody at 2.5 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Western Blot: Protein Kinase A regulatory subunit I alpha Antibody (6C7) [NBP1-47935] Analysis of extracts (35ug) from 9 different cell lines by using anti-Protein Kinase A regulatory subunit I alpha monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7) [NBP1-47935] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Protein Kinase A regulatory subunit I alpha.
Immunohistochemistry-Paraffin: Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7) [NBP1-47935] - Staining of paraffin-embedded carcinoma of bladder tissue (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min, Dilution 1:50).
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CAR/NR1I3 Antibody
(N4111)
PP-N4111-00
CAR/NR1I3 Antibody (N4111)
(6 Publications)
Species: Hu
Applications: WB, IHC, IP
TRIM13 Antibody
NBP1-85016
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Analysis in human testis and pancreas tissues. Corresponding TRIM13 RNA-seq data are presented for the same tissues.
Western Blot: TRIM13 Antibody [NBP1-85016] - Analysis in control (vector only transfected HEK293T lysate) and TRIM13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP1-85016] - Staining of human testis shows moderate dot-like cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, IHC, IHC-P
DIRAS3 Antibody
NBP1-90105
Immunocytochemistry/Immunofluorescence: DIRAS3 Antibody [NBP1-90105] - Staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: DIRAS3 Antibody [NBP1-90105] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Claudin-4 Antibody
NBP2-41187
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Colon Tissue Lysate. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (Lane 1: 1 ug/mL and Lane 2: 2 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Independent Antibody Validation (IAV) via Protein Expression Profile in Human Cell Lines. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), CLAUDIN4 from Company B (1 ug/mL), and beta-actin (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Cell Lines. Loading: 15 ug of lysates per lane.Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IF
PDZRN3 Antibody
NBP2-55802
PDZRN3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PDZRN3 Antibody (NBP2-55802)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for PDZRN3 Antibody (NBP2-55802) (0)

There are no reviews for PDZRN3 Antibody (NBP2-55802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDZRN3 Antibody (NBP2-55802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PDZRN3 Products

Bioinformatics Tool for PDZRN3 Antibody (NBP2-55802)

Discover related pathways, diseases and genes to PDZRN3 Antibody (NBP2-55802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZRN3 Antibody (NBP2-55802)

Discover more about diseases related to PDZRN3 Antibody (NBP2-55802).
 

Pathways for PDZRN3 Antibody (NBP2-55802)

View related products by pathway.

PTMs for PDZRN3 Antibody (NBP2-55802)

Learn more about PTMs related to PDZRN3 Antibody (NBP2-55802).
 

Research Areas for PDZRN3 Antibody (NBP2-55802)

Find related products by research area.

Blogs on PDZRN3

There are no specific blogs for PDZRN3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDZRN3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDZRN3