PDZD11 Antibody

Images

 
Western Blot: PDZ domain containing 11 Antibody [NBP1-80932] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: PDZ domain containing 11 Antibody [NBP1-80932] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDZD11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHR
Specificity
Specificity of human PDZD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZD11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDZD11 Protein (NBP1-80932PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDZD11 Antibody

  • AIPP1
  • ATPase-interacting PDZ protein
  • PDZ domain containing 11
  • PDZ domain-containing protein 11
  • PDZD11
  • PDZK11
  • PISP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1151
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-32463
Species: Hu
Applications: IHC, IHC-P
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF5520
Species: Hu, Mu
Applications: WB
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50247
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NBP2-58258
Species: Hu
Applications: WB, ICC/IF
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32557
Species: Hu
Applications: WB
AF3025
Species: Hu
Applications: WB, ELISA, ICC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-75626
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDZD11 Antibody (NBP1-80932) (0)

There are no publications for PDZD11 Antibody (NBP1-80932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDZD11 Antibody (NBP1-80932) (0)

There are no reviews for PDZD11 Antibody (NBP1-80932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDZD11 Antibody (NBP1-80932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDZD11 Antibody (NBP1-80932)

Discover related pathways, diseases and genes to PDZD11 Antibody (NBP1-80932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZD11 Antibody (NBP1-80932)

Discover more about diseases related to PDZD11 Antibody (NBP1-80932).
 

Pathways for PDZD11 Antibody (NBP1-80932)

View related products by pathway.

PTMs for PDZD11 Antibody (NBP1-80932)

Learn more about PTMs related to PDZD11 Antibody (NBP1-80932).

Blogs on PDZD11

There are no specific blogs for PDZD11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDZD11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZD11