PMCA3 Antibody

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-87259 antibody. Corresponding PMCA3 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: PMCA3 Antibody [NBP1-87259] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & the Golgi apparatus.

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebellum shows strong positivity in neuronal processes.

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal processes.

Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PMCA3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP2B3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PMCA3 Protein (NBP1-87259PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23416519)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMCA3 Antibody

• ATPase, Ca++ transporting, plasma membrane 3
• EC 3.6.3
• EC 3.6.3.8
• Plasma membrane calcium ATPase isoform 3
• plasma membrane calcium ATPase
• Plasma membrane calcium pump isoform 3
• plasma membrane calcium-transporting ATPase 3
• PMCA3a
• PMCA3plasma membrane calcium pump

Background

The protein encoded by the PMCA3 gene belongs to the family of P-type primary ion transport ATPases characterized by theformation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ionsfrom eukaryotic cells against very large concentration gradients and play a critical role in intracellular calciumhomeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and thediversity of these enzymes is further increased by alternative splicing of transcripts. The expression of differentisoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting thatthese pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes theplasma membrane calcium ATPase isoform 3. Alternatively spliced transcript variants encoding different isoforms havebeen identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMCA3 Antibody (NBP1-87259)(1)

Publication using NBP1-87259

• Beuschlein F, Boulkroun S, Osswald A et al. Somatic mutations in ATP1A1 and ATP2B3 lead to aldosterone-producing adenomas and secondary hypertension. Nat Genet 2013-04-01 [PMID: 23416519]

FAQs for PMCA3 Antibody (NBP1-87259). (Showing 1 - 2 of 2 FAQ).

1. I would like to know if this antibody can be stained the fixed sample by using aceton-methanol.
   • For our product NBP1-87259, this antibody is made to the cytoplasmic domain of the PMCA3 protein. For our ICC staining, we fix the cells with 4% paraformaldehyde pH 7.2 - 7.3 in growth medium supplemented with 10% fetal bovine serum (FBS) for 15 minutes on ice. It is possible that a acetone-methanol fixation may also work as the antibody will detect an epitope on the cytoplasmic side of the cell membrane.
2. And, what kind of fix solution did your IF data use?
   • I would recommend using the paraformaldehyde fixation if the results are inconclusive with the acetone-methanol fixation.

Bioinformatics

• Gene Symbol: ATP2B3