PMCA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PMCA3 Antibody [NBP1-87259] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & the Golgi apparatus.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human salivary gland shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: PMCA3 Antibody [NBP1-87259] - Staining of human cerebellum shows positivity in neuronal process.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMCA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP2B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PMCA3 Protein (NBP1-87259PEP)
Publications
Read Publication using NBP1-87259.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23416519)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMCA3 Antibody

  • ATPase, Ca++ transporting, plasma membrane 3
  • EC 3.6.3
  • EC 3.6.3.8
  • Plasma membrane calcium ATPase isoform 3
  • plasma membrane calcium ATPase
  • Plasma membrane calcium pump isoform 3
  • plasma membrane calcium-transporting ATPase 3
  • PMCA3a
  • PMCA3plasma membrane calcium pump

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-56483
Species: Hu
Applications: ICC/IF
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
H00000489-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-87259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PMCA3 Antibody (NBP1-87259)(1)

Reviews for PMCA3 Antibody (NBP1-87259) (0)

There are no reviews for PMCA3 Antibody (NBP1-87259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PMCA3 Antibody (NBP1-87259). (Showing 1 - 2 of 2 FAQ).

  1. I would like to know if this antibody can be stained the fixed sample by using aceton-methanol.
    • For our product NBP1-87259, this antibody is made to the cytoplasmic domain of the PMCA3 protein. For our ICC staining, we fix the cells with 4% paraformaldehyde pH 7.2 - 7.3 in growth medium supplemented with 10% fetal bovine serum (FBS) for 15 minutes on ice. It is possible that a acetone-methanol fixation may also work as the antibody will detect an epitope on the cytoplasmic side of the cell membrane.
  2. And, what kind of fix solution did your IF data use?
    • I would recommend using the paraformaldehyde fixation if the results are inconclusive with the acetone-methanol fixation.

Secondary Antibodies

 

Isotype Controls

Additional PMCA3 Products

Bioinformatics Tool for PMCA3 Antibody (NBP1-87259)

Discover related pathways, diseases and genes to PMCA3 Antibody (NBP1-87259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCA3 Antibody (NBP1-87259)

Discover more about diseases related to PMCA3 Antibody (NBP1-87259).
 

Pathways for PMCA3 Antibody (NBP1-87259)

View related products by pathway.

Blogs on PMCA3

There are no specific blogs for PMCA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMCA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2B3