PDK4 Recombinant Protein Antigen

Images

 
There are currently no images for PDK4 Recombinant Protein Antigen (NBP2-49235PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDK4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDK4.

Source: E. coli

Amino Acid Sequence: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49235.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDK4 Recombinant Protein Antigen

  • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial
  • EC 2.7.11
  • EC 2.7.11.2
  • FLJ40832
  • Pyruvate dehydrogenase kinase isoform 4
  • pyruvate dehydrogenase kinase, isoenzyme 4
  • pyruvate dehydrogenase kinase, isozyme 4
  • pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial

Background

Pyruvate dehydrogenase kinase isoform 4 (PDK4) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

PDK4 antibodies are useful tools for glucose metabolism research and mitochondiral metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
H00005164-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP2-24608
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
NB100-53791
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB864
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-637
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for PDK4 Recombinant Protein Antigen (NBP2-49235PEP) (0)

There are no publications for PDK4 Recombinant Protein Antigen (NBP2-49235PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK4 Recombinant Protein Antigen (NBP2-49235PEP) (0)

There are no reviews for PDK4 Recombinant Protein Antigen (NBP2-49235PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDK4 Recombinant Protein Antigen (NBP2-49235PEP). (Showing 1 - 1 of 1 FAQ).

  1. Which PDK4 antibody do you recommend for immunoblot? I'm working with human cell lines.
    • NBP1-07047 and NBP1-07049 are our best selling PDK4 antibodies that will meet your mentioned criteria i.e. Immunoblot/Western Blot in Human samples. However, all of our products are 100% guaranteed and you may find a complete list of PDK4 antibodies by searching PDK4 on our website and narrowing your results using the filters on the left-hand side of the screen.

Additional PDK4 Products

Research Areas for PDK4 Recombinant Protein Antigen (NBP2-49235PEP)

Find related products by research area.

Blogs on PDK4

There are no specific blogs for PDK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDK4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK4