PDIR Recombinant Protein Antigen

Images

 
There are currently no images for PDIR Protein (NBP1-92250PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDIR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDIA5.

Source: E.coli

Amino Acid Sequence: HCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDSDRTELGFTNYIRALREGDHERLGK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDIA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92250.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PDIR Recombinant Protein Antigen

  • FLJ30401
  • PDIREC 5.3.4.1
  • protein disulfide isomerase family A, member 5
  • protein disulfide isomerase-associated 5
  • Protein disulfide isomerase-related protein
  • protein disulfide-isomerase A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB, ICC/IF, IHC, IP
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IHC-FrFl
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Mk, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N
NBP2-76846
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
MAB3446
Species: Hu
Applications: WB
AF1543
Species: Hu
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49532
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-42187
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC
NB100-2525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for PDIR Protein (NBP1-92250PEP) (0)

There are no publications for PDIR Protein (NBP1-92250PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIR Protein (NBP1-92250PEP) (0)

There are no reviews for PDIR Protein (NBP1-92250PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDIR Protein (NBP1-92250PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PDIR Products

Bioinformatics Tool for PDIR Protein (NBP1-92250PEP)

Discover related pathways, diseases and genes to PDIR Protein (NBP1-92250PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIR Protein (NBP1-92250PEP)

Discover more about diseases related to PDIR Protein (NBP1-92250PEP).
 

Pathways for PDIR Protein (NBP1-92250PEP)

View related products by pathway.

PTMs for PDIR Protein (NBP1-92250PEP)

Learn more about PTMs related to PDIR Protein (NBP1-92250PEP).

Blogs on PDIR

There are no specific blogs for PDIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDIR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA5