PDIA6 Antibody

Images

 
Genetic Strategies: Western Blot: PDIA6 Antibody [NBP2-38213] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: PDIA6 Antibody [NBP2-38213] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human thyroid gland using Anti-PDIA6 antibody NBP2-38213.
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human thyroid gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining in human thyroid gland and skeletal muscle tissues using anti-PDIA6 antibody. Corresponding PDIA6 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human cerebral cortex, epididymis, skeletal muscle and thyroid gland using Anti-PDIA6 antibody NBP2-38213 (A) shows ...read more
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human epididymis.
Immunohistochemistry-Paraffin: PDIA6 Antibody [NBP2-38213] - Staining of human skeletal muscle using Anti-PDIA6 antibody NBP2-38213.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDIA6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDIA6 Protein (NBP2-38213PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDIA6 Antibody

  • EC 5.3.4.1
  • Endoplasmic reticulum protein 5
  • ERp5
  • ERP5ER protein 5
  • P5TXNDC7
  • protein disulfide isomerase family A, member 6
  • Protein disulfide isomerase P5
  • protein disulfide isomerase-associated 6
  • protein disulfide isomerase-related protein
  • protein disulfide-isomerase A6
  • thioredoxin domain containing 7 (protein disulfide isomerase)
  • Thioredoxin domain-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59875
Species: Hu
Applications: WB
NBP2-97759
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-22261
Species: Ch, Hu, Mu
Applications: IP, WB

Publications for PDIA6 Antibody (NBP2-38213) (0)

There are no publications for PDIA6 Antibody (NBP2-38213).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIA6 Antibody (NBP2-38213) (0)

There are no reviews for PDIA6 Antibody (NBP2-38213). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDIA6 Antibody (NBP2-38213) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDIA6 Products

Bioinformatics Tool for PDIA6 Antibody (NBP2-38213)

Discover related pathways, diseases and genes to PDIA6 Antibody (NBP2-38213). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIA6 Antibody (NBP2-38213)

Discover more about diseases related to PDIA6 Antibody (NBP2-38213).
 

Pathways for PDIA6 Antibody (NBP2-38213)

View related products by pathway.

Research Areas for PDIA6 Antibody (NBP2-38213)

Find related products by research area.

Blogs on PDIA6

There are no specific blogs for PDIA6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDIA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA6
Uniprot