PDIA6 Antibody

Images

 
Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type : Mouse Brain lysate
Immunocytochemistry/ Immunofluorescence: PDIA6 Antibody [NBP1-57999] - NT2 cells Red: Antibody Blue: DAPI Primary Dilution: 1ug/50ul antibody Secondary Antibody: Alexa goat anti-rabbit 594 Image Submitted by: Yuzhi ...read more
Western Blot: PDIA6 Antibody [NBP1-57999] - Mouse Brain lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: PDIA6 Antibody [NBP1-57999] - Titration: 2 ug/ml Positive Control: Human NT2 cell lysate
Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Type: 2. mouse brain extracts (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit Secondary Antibody Dilution: 1: 20,000
Western Blot: PDIA6 Antibody [NBP1-57999] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human ...read more
Western Blot: PDIA6 Antibody [NBP1-57999] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Ca, EqSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDIA6 Antibody Summary

Immunogen
Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Porcine (93%), Canine (93%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PDIA6 and was validated on Western blot.
Control
PDIA6 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDIA6 Antibody

  • EC 5.3.4.1
  • Endoplasmic reticulum protein 5
  • ERp5
  • ERP5ER protein 5
  • P5TXNDC7
  • protein disulfide isomerase family A, member 6
  • Protein disulfide isomerase P5
  • protein disulfide isomerase-associated 6
  • protein disulfide isomerase-related protein
  • protein disulfide-isomerase A6
  • thioredoxin domain containing 7 (protein disulfide isomerase)
  • Thioredoxin domain-containing protein 7

Background

Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 BF979486.1 11-49 40-1858 BC001312.1 1-1819 1859-2326 AK127433.1 2215-2682 2327-2344 BM511594.1 1-18 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-62583
Species: Hu
Applications: WB
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59875
Species: Hu
Applications: WB
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-91874
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDIA6 Antibody (NBP1-57999) (0)

There are no publications for PDIA6 Antibody (NBP1-57999).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDIA6 Antibody (NBP1-57999) (0)

There are no reviews for PDIA6 Antibody (NBP1-57999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDIA6 Antibody (NBP1-57999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDIA6 Products

Bioinformatics Tool for PDIA6 Antibody (NBP1-57999)

Discover related pathways, diseases and genes to PDIA6 Antibody (NBP1-57999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIA6 Antibody (NBP1-57999)

Discover more about diseases related to PDIA6 Antibody (NBP1-57999).
 

Pathways for PDIA6 Antibody (NBP1-57999)

View related products by pathway.

Blogs on PDIA6

There are no specific blogs for PDIA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDIA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA6
Uniprot