PDGFA Antibody

Images

 
Western Blot: PDGFA Antibody [NBP2-82303] - Host: Rabbit. Target Name: PDGFA. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDGFA Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDGFA. Peptide sequence: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PDGFA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDGFA Antibody

  • PDGF-1
  • PDGF1PDGF A-chain
  • PDGF-A
  • Platelet-derived growth factor A chain
  • platelet-derived growth factor alpha chain
  • platelet-derived growth factor alpha isoform 2 preproprotein
  • platelet-derived growth factor alpha polypeptidePDGF subunit A
  • platelet-derived growth factor subunit A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52533
Species: Bv, Ca, Hu, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
233-FB/CF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
AF1042
Species: Mu
Applications: IHC, WB
1687-CC/CF
Species: Hu
Applications: BA
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1062
Species: Mu
Applications: IHC, Neut, WB
236-EG
Species: Hu
Applications: BA
220-BB
Species: Hu
Applications: BA
D6050
Species: Hu
Applications: ELISA
1159-SB/CF
Species: Hu
Applications: BA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Publications for PDGFA Antibody (NBP2-82303) (0)

There are no publications for PDGFA Antibody (NBP2-82303).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDGFA Antibody (NBP2-82303) (0)

There are no reviews for PDGFA Antibody (NBP2-82303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDGFA Antibody (NBP2-82303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDGFA Products

Bioinformatics Tool for PDGFA Antibody (NBP2-82303)

Discover related pathways, diseases and genes to PDGFA Antibody (NBP2-82303). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDGFA Antibody (NBP2-82303)

Discover more about diseases related to PDGFA Antibody (NBP2-82303).
 

Pathways for PDGFA Antibody (NBP2-82303)

View related products by pathway.

PTMs for PDGFA Antibody (NBP2-82303)

Learn more about PTMs related to PDGFA Antibody (NBP2-82303).
 

Research Areas for PDGFA Antibody (NBP2-82303)

Find related products by research area.

Blogs on PDGFA.

Simplifying IL6 Antibody Assays with ELISA kits
Interleukin 6 is a complex pleiotropic cytokine having both anti and pro-inflammatory effects. Alterations in expression contribute to many human diseases, and the IL6 antibody is widely used in the research areas of innate and adaptive immunity, auto...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDGFA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDGFA