PDGF R beta Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PDGF R beta Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFRB.
  
  

  Source: E. coli

  Amino Acid Sequence: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PDGFRB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88134.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDGF R beta Recombinant Protein Antigen

• beta-type platelet-derived growth factor receptor
• CD140 antigen-like family member B
• CD140b antigen
• CD140b
• EC 2.7.10
• EC 2.7.10.1
• JTK12
• PDGF R beta
• PDGFR
• PDGFR1
• PDGFRB
• PDGF-R-beta
• platelet-derived growth factor receptor, beta polypeptide

Background

Human platelet-derived growth factor (PDGF) receptor, is a receptor tyrosine kinase whose activity induces various signalling cascades leading to cell growth and proliferation. Two major isoforms exist, PDGF receptor-alpha and PDGF receptor-beta. PDGF receptor-beta can only bind two specific PDGF isoforms, PDGF-beta and PDGF-delta (1,2). Upon ligand binding, the receptor undergoes autophosphorylation, allowing binding and activation of cytoplasmic SH2 domain-containing signal transduction molecules such as PI kinase (3), Grb2, and Src, among others.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDGFRB