We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PDGF R beta Recombinant Protein Antigen

Images

 
There are currently no images for PDGF R beta Protein (NBP1-88134PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDGF R beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFRB.

Source: E. coli

Amino Acid Sequence: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDGFRB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88134.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDGF R beta Recombinant Protein Antigen

  • beta-type platelet-derived growth factor receptor
  • CD140 antigen-like family member B
  • CD140b antigen
  • CD140b
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK12
  • PDGF R beta
  • PDGFR
  • PDGFR1
  • PDGFRB
  • PDGF-R-beta
  • platelet-derived growth factor receptor, beta polypeptide

Background

Human platelet-derived growth factor (PDGF) receptor, is a receptor tyrosine kinase whose activity induces various signalling cascades leading to cell growth and proliferation. Two major isoforms exist, PDGF receptor-alpha and PDGF receptor-beta. PDGF receptor-beta can only bind two specific PDGF isoforms, PDGF-beta and PDGF-delta (1,2). Upon ligand binding, the receptor undergoes autophosphorylation, allowing binding and activation of cytoplasmic SH2 domain-containing signal transduction molecules such as PI kinase (3), Grb2, and Src, among others.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1062
Species: Mu
Applications: Flow, IHC, Neut, WB
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
DVE00
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-52533
Species: Bv, Ca, Hu, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP2-42210
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
221-AA
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
NBP3-35070
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no publications for PDGF R beta Protein (NBP1-88134PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no reviews for PDGF R beta Protein (NBP1-88134PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDGF R beta Protein (NBP1-88134PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDGF R beta Products

Research Areas for PDGF R beta Protein (NBP1-88134PEP)

Find related products by research area.

Blogs on PDGF R beta

There are no specific blogs for PDGF R beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDGF R beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDGFRB