PDGF-C Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFC. Source: E. coli
Amino Acid Sequence: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PDGFC |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83935. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PDGF-C Recombinant Protein Antigen
Background
PDGFC, also known as Platelet-derived growth factor C, has 3 isoforms, a 345 amino acid isoform that is 39 kDa, a 282 amino acid isoform that is 32 kDa and a 167 amino acid isoform that is 19 kDa, expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract and retinal pigment epithelia; plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis, wound healing, represents potent mitogen for cells of mesenchymal origin, induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis, can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix. This protein is being studied for its involvement in mesangial proliferative glomerulonephritis, proliferative glomerulonephritis, glomerulonephritis, brain cancer, prostate carcinoma, nephropathy, prostatitis, prostate cancer, atherosclerosis, retinitis, melanoma, and carcinoma. The protein has been linked to the cytoskeleton remodeling role of PDGFs in cell migration, development PDGF signaling via MAPK cascades, release of novel PDGFs as latent factors, signal transduction, signaling by PD, focal adhesion, gap junction, regulation of actin cytoskeleton, prostate cancer, and melanoma GF pathways where it interacts with PDGFRB, PDGFRA, PLAT, PLAU, PLAUR, EGFR, ERBB2, FGFR1, FLT1, and FLT4 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: AC
Publications for PDGF-C Protein (NBP1-83935PEP) (0)
There are no publications for PDGF-C Protein (NBP1-83935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDGF-C Protein (NBP1-83935PEP) (0)
There are no reviews for PDGF-C Protein (NBP1-83935PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PDGF-C Protein (NBP1-83935PEP) (0)
Additional PDGF-C Products
Research Areas for PDGF-C Protein (NBP1-83935PEP)
Find related products by research area.
|
Blogs on PDGF-C