PDGF-C Recombinant Protein Antigen

Images

 
There are currently no images for PDGF-C Protein (NBP1-83935PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PDGF-C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFC.

Source: E. coli

Amino Acid Sequence: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDGFC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83935.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDGF-C Recombinant Protein Antigen

  • FALLOTEIN
  • PDGFC
  • PDGF-C
  • platelet derived growth factor C
  • platelet-derived growth factor C
  • SCDGFSpinal cord-derived growth factor
  • secretory growth factor-like protein
  • VEGF-E

Background

PDGFC, also known as Platelet-derived growth factor C, has 3 isoforms, a 345 amino acid isoform that is 39 kDa, a 282 amino acid isoform that is 32 kDa and a 167 amino acid isoform that is 19 kDa, expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract and retinal pigment epithelia; plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis, wound healing, represents potent mitogen for cells of mesenchymal origin, induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis, can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix. This protein is being studied for its involvement in mesangial proliferative glomerulonephritis, proliferative glomerulonephritis, glomerulonephritis, brain cancer, prostate carcinoma, nephropathy, prostatitis, prostate cancer, atherosclerosis, retinitis, melanoma, and carcinoma. The protein has been linked to the cytoskeleton remodeling role of PDGFs in cell migration, development PDGF signaling via MAPK cascades, release of novel PDGFs as latent factors, signal transduction, signaling by PD, focal adhesion, gap junction, regulation of actin cytoskeleton, prostate cancer, and melanoma GF pathways where it interacts with PDGFRB, PDGFRA, PLAT, PLAU, PLAUR, EGFR, ERBB2, FGFR1, FLT1, and FLT4 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
1159-SB
Species: Hu
Applications: BA
221-AA
Species: Hu
Applications: BA
NBP1-58279
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
DPG00
Species: Hu
Applications: ELISA
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
AF1062
Species: Mu
Applications: Flow, IHC, Neut, WB
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
DVEC00
Species: Hu
Applications: ELISA
233-FB
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-83935PEP
Species: Hu
Applications: AC

Publications for PDGF-C Protein (NBP1-83935PEP) (0)

There are no publications for PDGF-C Protein (NBP1-83935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDGF-C Protein (NBP1-83935PEP) (0)

There are no reviews for PDGF-C Protein (NBP1-83935PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDGF-C Protein (NBP1-83935PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDGF-C Products

Research Areas for PDGF-C Protein (NBP1-83935PEP)

Find related products by research area.

Blogs on PDGF-C

There are no specific blogs for PDGF-C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDGF-C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDGFC