PDE8B Antibody


Immunohistochemistry-Paraffin: PDE8B Antibody [NBP1-86280] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: PDE8B Antibody [NBP1-86280] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PDE8B Antibody [NBP1-86280] - Staining in human thyroid gland and skeletal muscle tissues using anti-PDE8B antibody. Corresponding PDE8B RNA-seq data are ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PDE8B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
Specificity of human PDE8B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PDE8B Antibody

  • 3'-5' cyclic nucleotide phosphodiesterase 8B
  • ADSD
  • Cell proliferation-inducing gene 22 protein
  • EC
  • FLJ11212
  • high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B
  • hsPDE8B
  • phosphodiesterase 8B
  • PPNAD3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA
Species: Hu, Bv
Applications: WB, DB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
Species: Ec
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P

Publications for PDE8B Antibody (NBP1-86280) (0)

There are no publications for PDE8B Antibody (NBP1-86280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE8B Antibody (NBP1-86280) (0)

There are no reviews for PDE8B Antibody (NBP1-86280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDE8B Antibody (NBP1-86280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PDE8B Products

Array NBP1-86280

Bioinformatics Tool for PDE8B Antibody (NBP1-86280)

Discover related pathways, diseases and genes to PDE8B Antibody (NBP1-86280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE8B Antibody (NBP1-86280)

Discover more about diseases related to PDE8B Antibody (NBP1-86280).

Pathways for PDE8B Antibody (NBP1-86280)

View related products by pathway.

PTMs for PDE8B Antibody (NBP1-86280)

Learn more about PTMs related to PDE8B Antibody (NBP1-86280).

Research Areas for PDE8B Antibody (NBP1-86280)

Find related products by research area.

Blogs on PDE8B

There are no specific blogs for PDE8B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PDE8B Antibody and receive a gift card or discount.


Gene Symbol PDE8B