PDE8B Antibody

Images

 
Immunohistochemistry-Paraffin: PDE8B Antibody [NBP1-86280] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE8B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDE8B Protein (NBP1-86280PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE8B Antibody

  • 3'-5' cyclic nucleotide phosphodiesterase 8B
  • ADSD
  • Cell proliferation-inducing gene 22 protein
  • EC 3.1.4.17
  • FLJ11212
  • high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B
  • hsPDE8B
  • phosphodiesterase 8B
  • PPNAD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP1-85922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
1670-SE
Species: Ec
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37404
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDE8B Antibody (NBP1-86280) (0)

There are no publications for PDE8B Antibody (NBP1-86280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE8B Antibody (NBP1-86280) (0)

There are no reviews for PDE8B Antibody (NBP1-86280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDE8B Antibody (NBP1-86280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE8B Products

Bioinformatics Tool for PDE8B Antibody (NBP1-86280)

Discover related pathways, diseases and genes to PDE8B Antibody (NBP1-86280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE8B Antibody (NBP1-86280)

Discover more about diseases related to PDE8B Antibody (NBP1-86280).
 

Pathways for PDE8B Antibody (NBP1-86280)

View related products by pathway.

PTMs for PDE8B Antibody (NBP1-86280)

Learn more about PTMs related to PDE8B Antibody (NBP1-86280).
 

Research Areas for PDE8B Antibody (NBP1-86280)

Find related products by research area.

Blogs on PDE8B

There are no specific blogs for PDE8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE8B