PDCD4 Antibody - BSA Free

Western Blot: PDCD4 Antibody [NBP3-03401] - Western blot analysis of extracts from normal (control) and PDCD4 knockout (KO) 293T cells, using PDCD4 antibody (NBP3-03401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP3-03401] - Immunohistochemistry of paraffin-embedded human placenta using [KO Validated] PDCD4 Rabbit pAb (NBP3-03401) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Western Blot: PDCD4 Antibody [NBP3-03401] - Western blot analysis of extracts of various cell lines, using PDCD4 antibody (NBP3-03401) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP3-03401] - Immunohistochemistry of paraffin-embedded human thyroid cancer using [KO Validated] PDCD4 Rabbit pAb (NBP3-03401) at dilution of 1:25 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: WB, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDCD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit PDCD4 Antibody - BSA Free (NBP3-03401) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PDCD4 (NP_055271.2). MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDCD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDCD4 Antibody - BSA Free

• H731
• H731nuclear antigen H731
• MGC33046
• MGC33047
• Neoplastic transformation inhibitor protein
• Nuclear antigen H731-like
• PDCD4
• programmed cell death 4 (neoplastic transformation inhibitor)
• programmed cell death protein 4
• Protein 197/15a

Background

Programmed cell death 4 (Pdcd4) is a novel tumor suppressor. Pdcd4 directly inhibits the helicase activity of eukaryotic translation initiation factor 4A (eIF4A), a component of the translation initiation complex. Pdcd4 also suppresses the transactivation of activator protein-1 (AP-1)-responsive promoters by c-Jun. Pdcd4 contains two Akt phosphorylation sites, one at Ser67 and the other at Ser457. The phosphorylation of Pdcd4 by Akt causes nuclear translocation of Pdcd4 and a significant decrease in the ability of Pdcd4 to interfere with the transactivation of AP-1 responsive promoters by c-Jun.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDCD4