PD-L2/B7-DC/PDCD1LG2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDCD1LG2. Source: E. coli
Amino Acid Sequence: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PDCD1LG2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88964. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PD-L2/B7-DC/PDCD1LG2 Recombinant Protein Antigen
Background
B7-DC is also called programmed death ligand 2 (PDL2). It has recently been clustered as CD273. This ligand is a 42 kD member of the immunoglobulin receptor superfamily expressed on a subset of dendritic cells, liver and a small subset of macrophages as well as a few transformed cell lines. B7-DC (CD273) has been reported to be stimulatory on dendritic cells when cross-linked and to inhibit T cell activation upon engaging the PD-1 receptor. B7-DC (CD273) has also been reported to bind to an alternative receptor and to mediate T cell activation through such non-PD1 mediated interactions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: IHC, WB
Publications for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP) (0)
There are no publications for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP) (0)
There are no reviews for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP) (0)
Additional PD-L2/B7-DC/PDCD1LG2 Products
Research Areas for PD-L2/B7-DC/PDCD1LG2 Protein (NBP1-88964PEP)
Find related products by research area.
|
Blogs on PD-L2/B7-DC/PDCD1LG2