PCYT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar protein distribution across tissues to independent antibody NBP1-83951 (B).

Western Blot: PCYT2 Antibody [NBP1-83952] - Analysis using Anti-PCYT2 antibody NBP1-83952 (A) shows similar pattern to independent antibody NBP1-83951 (B).

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83952] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCYT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCYT2 Antibody - BSA Free (NBP1-83952) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPG
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCYT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PCYT2 Protein (NBP1-83952PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCYT2 Antibody - BSA Free

• CTP:phosphoethanolamine cytidylyltransferase
• EC 2.7.7
• EC 2.7.7.14
• ET
• ethanolamine-phosphate cytidylyltransferase
• PCYT2
• phosphate cytidylyltransferase 2, ethanolamine
• Phosphorylethanolamine transferase

Background

ECT (ethanolamine phosphate cytidyltransferase) is an important regulatory enzyme in the pathway for phosphatidylethanolamine (PE) biosynthesis. PE functions in cell signalling, membrane fusion, platelet activation, and cell cycle progression. Specialized forms of PE exist as plasmologens, natural cannabinoid anadimade, and glycosylated PE. The ECT enzyme acts in the second of three catalysis steps to produce CDP-ethanolamine from phosphoethanolamine (P-Etn). Study of ECT could help determine the role of plasmologens in disease, specifically lipid disorders such as peroxisomal diseases as well as neuronal degeneration associated with Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCYT2