PCYOX1 Antibody (3D7-D8)

Images

 
There are currently no images for PCYOX1 Antibody (H00051449-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3D7-D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCYOX1 Antibody (3D7-D8) Summary

Immunogen
PCYOX1 (AAH33815, 1 a.a. ~ 506 a.a) full length recombinant protein with GST tag.MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGA GIGGTSAAYYLRQKFGKDVKIDLFEREEVGGRLATMMVQGQE YEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIYNGETL VFEESNWFIINVIKLVWRYGFQSLRMHMWVEDVLDKFMRIYR YQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSE KFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDS
Localization
Lysosome
Specificity
PCYOX1 - prenylcysteine oxidase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCYOX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCYOX1 Antibody (3D7-D8)

  • EC 1.8.3.5
  • KIAA0908PCL1Prenylcysteine lyase
  • prenylcysteine oxidase 1

Background

Prenylcysteine is released during the degradation of prenylated proteins. PCYOX1 catalyzes the degradation of prenylcysteine to yield free cysteines and a hydrophobic isoprenoid product (Tschantz et al., 1999 [PubMed 10585463]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6846
Species: Hu
Applications: IHC
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007702-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF7558
Species: Hu, Mu, Rt
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-43782
Species: Hu
Applications: WB
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-52926
Species: Hu
Applications: WB
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00051449-M01
Species: Hu
Applications: ELISA

Publications for PCYOX1 Antibody (H00051449-M01) (0)

There are no publications for PCYOX1 Antibody (H00051449-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYOX1 Antibody (H00051449-M01) (0)

There are no reviews for PCYOX1 Antibody (H00051449-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCYOX1 Antibody (H00051449-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYOX1 Products

Bioinformatics Tool for PCYOX1 Antibody (H00051449-M01)

Discover related pathways, diseases and genes to PCYOX1 Antibody (H00051449-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYOX1 Antibody (H00051449-M01)

Discover more about diseases related to PCYOX1 Antibody (H00051449-M01).
 

Pathways for PCYOX1 Antibody (H00051449-M01)

View related products by pathway.

PTMs for PCYOX1 Antibody (H00051449-M01)

Learn more about PTMs related to PCYOX1 Antibody (H00051449-M01).

Blogs on PCYOX1

There are no specific blogs for PCYOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYOX1 Antibody (3D7-D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYOX1
Entrez
Uniprot