PCTP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCTP Antibody [NBP2-13742] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PCTP Antibody [NBP2-13742] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCTP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLY EYKVFGVLEDCSPTLLAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCTP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCTP Protein (NBP2-13742PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCTP Antibody

  • PC-TP
  • phosphatidylcholine transfer protein
  • StARD2
  • STARD2StAR-related lipid transfer (START) domain containing 2
  • StAR-related lipid transfer protein 2
  • START domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4538
Species: Hu, Mu, Rt
Applications: WB
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-34132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010948-M01
Species: Hu
Applications: WB, ELISA
NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCTP Antibody (NBP2-13742) (0)

There are no publications for PCTP Antibody (NBP2-13742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTP Antibody (NBP2-13742) (0)

There are no reviews for PCTP Antibody (NBP2-13742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCTP Antibody (NBP2-13742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCTP Products

Bioinformatics Tool for PCTP Antibody (NBP2-13742)

Discover related pathways, diseases and genes to PCTP Antibody (NBP2-13742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTP Antibody (NBP2-13742)

Discover more about diseases related to PCTP Antibody (NBP2-13742).
 

Pathways for PCTP Antibody (NBP2-13742)

View related products by pathway.

PTMs for PCTP Antibody (NBP2-13742)

Learn more about PTMs related to PCTP Antibody (NBP2-13742).

Blogs on PCTP

There are no specific blogs for PCTP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCTP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCTP