PCTAIRE2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCTAIRE2 Antibody [NBP1-87316] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: PCTAIRE2 Antibody [NBP1-87316] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells,.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCTAIRE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCTAIRE2 Protein (NBP1-87316PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCTAIRE2 Antibody

  • Cell division protein kinase 17
  • cyclin-dependent kinase 17
  • EC 2.7.11
  • EC 2.7.11.22
  • PCTAIRE protein kinase 2
  • PCTAIRE2
  • PCTAIRE-motif protein kinase 2
  • PCTK2
  • protein kinase cdc2-related PCTAIRE-2
  • Serine/threonine-protein kinase PCTAIRE-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91445
Species: Hu
Applications: WB
H00023415-R03
Species: Hu
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56016
Species: Hu
Applications: WB, ICC/IF
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-30594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87316
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PCTAIRE2 Antibody (NBP1-87316) (0)

There are no publications for PCTAIRE2 Antibody (NBP1-87316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTAIRE2 Antibody (NBP1-87316) (0)

There are no reviews for PCTAIRE2 Antibody (NBP1-87316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCTAIRE2 Antibody (NBP1-87316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCTAIRE2 Products

Bioinformatics Tool for PCTAIRE2 Antibody (NBP1-87316)

Discover related pathways, diseases and genes to PCTAIRE2 Antibody (NBP1-87316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCTAIRE2 Antibody (NBP1-87316)

Discover more about diseases related to PCTAIRE2 Antibody (NBP1-87316).
 

Pathways for PCTAIRE2 Antibody (NBP1-87316)

View related products by pathway.

Research Areas for PCTAIRE2 Antibody (NBP1-87316)

Find related products by research area.

Blogs on PCTAIRE2

There are no specific blogs for PCTAIRE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCTAIRE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK17