PCPE-1/PCOLCE Antibody - BSA Free

Western Blot: PCPE-1/PCOLCE Antibody [NBP2-55270] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: PCPE-1/PCOLCE Antibody [NBP2-55270] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCPE-1/PCOLCE Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PCPE-1/PCOLCE Antibody - BSA Free (NBP2-55270) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCOLCE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PCPE-1/PCOLCE Recombinant Protein Antigen (NBP2-55270PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCPE-1/PCOLCE Antibody - BSA Free

• PCOLCE
• PCPE
• PCPE1
• PCPE-1
• PCPE1Type I procollagen COOH-terminal proteinase enhancer
• procollagen C-endopeptidase enhancer 1
• procollagen C-endopeptidase enhancer
• Procollagen COOH-terminal proteinase enhancer 1
• Procollagen C-proteinase enhancer 1
• procollagen, type 1, COOH-terminal proteinase enhancer
• Type 1 procollagen C-proteinase enhancer protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCOLCE