PCNA associated factor Antibody (3C11-1F11)

Images

 
Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Western Blot analysis of KIAA0101 expression in JAR ( Cat # L003V1 ).
Immunocytochemistry/ Immunofluorescence: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. Antibody ...read more
ELISA: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3C11-1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCNA associated factor Antibody (3C11-1F11) Summary

Immunogen
KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Localization
Mitochondrial and Nuclear
Specificity
KIAA0101 - KIAA0101
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCLAF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00009768-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCNA associated factor Antibody (3C11-1F11)

  • HCV NS5A-transactivated protein 9
  • Hepatitis C virus NS5A-transactivated protein 9
  • KIAA0101
  • NS5ATP9p15PAF
  • OEATC-1OEATC1
  • Overexpressed in anaplastic thyroid carcinoma 1
  • p15(PAF)
  • PAF
  • PCNA-associated factor

Background

KIAA0101/NS5ATP9/PAF/p15(PAF) is involved in protection of cells from UV-induced cell death and is also a Hepatitis C NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCNA associated factor Antibody (H00009768-M01)(10)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 10.
Publications using H00009768-M01 Applications Species
Anchalee T, Ravat P, Pattana S et al. PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues. BMC Cancer. 2021-03-20 [PMID: 33743635]
He C, Jing Z, Yinan Y et al. Overexpression of KIAA0101 Promotes the Progression of Non-small Cell Lung Cancer. J Cancer. 2020-09-23 [PMID: 33046987]
Tuanhe S, Qi A, Rong Y et al. MicroRNA-216a-5p suppresses esophageal squamous cell carcinoma progression by targeting KIAA0101. Oncol Rep. 2020-09-04 [PMID: 32901882]
DST Ong, B Hu, YW Ho, CG Sauvé, CA Bristow, Q Wang, AS Multani, P Chen, L Nezi, S Jiang, CE Gorman, MM Monasterio, D Koul, M Marchesini, S Colla, EJ Jin, EP Sulman, DJ Spring, WA Yung, RGW Verhaak, L Chin, YA Wang, RA DePinho PAF promotes stemness and radioresistance of glioma stem cells Proc. Natl. Acad. Sci. U.S.A., 2017-10-09;114(43):E9086-E9095. 2017-10-09 [PMID: 29073105]
Yuan D, Zhu K, Dang C et al. NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer. Med Oncol. 2014-07-05 [PMID: 24996800]
Cheng Y, Li K, Diao D et al. Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro. Lab Invest. 2013-10-21 [PMID: 24145239]
Chang CN, Feng MJ, Chen YL et al. p15PAF Is an Rb/E2F-Regulated S-Phase Protein Essential for DNA Synthesis and Cell Cycle Progression. PLoS One. 2013-04-04 [PMID: 23593430]
Shubbar E, Kovacs A, Hajizadeh S et al. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. BMC Cancer 2013-01-02 [PMID: 23282137] (IF/IHC, Human) IF/IHC Human
Kato T, Daigo Y, Aragaki M et al. Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients. Lung Cancer. 2011-06-18 [PMID: 21689861]
Yuan RH, Jeng YM, Pan HW et al. Overexpression of KIAA0101 Predicts High Stage, Early Tumor Recurrence, Poor Prognosis of Hepatocellular Carcinoma. Clin Cancer Res;13(18):5368-76. 2007-09-15 [PMID: 17875765]

Reviews for PCNA associated factor Antibody (H00009768-M01) (0)

There are no reviews for PCNA associated factor Antibody (H00009768-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCNA associated factor Antibody (H00009768-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCNA associated factor Products

Research Areas for PCNA associated factor Antibody (H00009768-M01)

Find related products by research area.

Blogs on PCNA associated factor

There are no specific blogs for PCNA associated factor, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCNA associated factor Antibody (3C11-1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCLAF
Entrez
Uniprot