PCNA associated factor Antibody (3C11-1F11)

Images

 
Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Western Blot analysis of KIAA0101 expression in JAR ( Cat # L003V1 ).
Immunocytochemistry/ Immunofluorescence: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. Antibody ...read more
ELISA: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3C11-1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCNA associated factor Antibody (3C11-1F11) Summary

Immunogen
KIAA0101 (AAH05832, 1 a.a. ~ 112 a.a) full length recombinant protein with GST tag.MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRK AENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPE EAGSSGLGKAKRKACPLQPDHTNDEKE
Localization
Mitochondrial and Nuclear
Specificity
KIAA0101 - KIAA0101
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KIAA0101
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00009768-M01 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCNA associated factor Antibody (3C11-1F11)

  • HCV NS5A-transactivated protein 9
  • Hepatitis C virus NS5A-transactivated protein 9
  • KIAA0101
  • NS5ATP9p15PAF
  • OEATC-1OEATC1
  • Overexpressed in anaplastic thyroid carcinoma 1
  • p15(PAF)
  • PAF
  • PCNA-associated factor

Background

KIAA0101/NS5ATP9/PAF/p15(PAF) is involved in protection of cells from UV-induced cell death and is also a Hepatitis C NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PCNA associated factor Antibody (H00009768-M01)(6)

Reviews for PCNA associated factor Antibody (H00009768-M01) (0)

There are no reviews for PCNA associated factor Antibody (H00009768-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCNA associated factor Antibody (H00009768-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCNA associated factor Products

Bioinformatics Tool for PCNA associated factor Antibody (H00009768-M01)

Discover related pathways, diseases and genes to PCNA associated factor Antibody (H00009768-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCNA associated factor Antibody (H00009768-M01)

Discover more about diseases related to PCNA associated factor Antibody (H00009768-M01).
 

Pathways for PCNA associated factor Antibody (H00009768-M01)

View related products by pathway.

PTMs for PCNA associated factor Antibody (H00009768-M01)

Learn more about PTMs related to PCNA associated factor Antibody (H00009768-M01).
 

Research Areas for PCNA associated factor Antibody (H00009768-M01)

Find related products by research area.

Blogs on PCNA associated factor

There are no specific blogs for PCNA associated factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCNA associated factor Antibody (3C11-1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0101
Entrez
Uniprot