PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free

Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Western Blot analysis of KIAA0101 expression in JAR ( Cat # L003V1 ).

Immunocytochemistry/Immunofluorescence: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. Antibody concentration 3 ug/ml.

ELISA: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3C11-1F11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free (H00009768-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-PCNA associated factor Antibody: Cited in 10 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: KIAA0101 (AAH05832, 1 a.a. ~ 111 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
• Localization: Mitochondrial and Nuclear
• Specificity: KIAA0101 - KIAA0101
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PCLAF
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCNA associated factor Antibody (3C11-1F11) - Azide and BSA Free

• HCV NS5A-transactivated protein 9
• Hepatitis C virus NS5A-transactivated protein 9
• KIAA0101
• NS5ATP9p15PAF
• OEATC-1OEATC1
• Overexpressed in anaplastic thyroid carcinoma 1
• p15(PAF)
• PAF
• PCNA-associated factor

Background

KIAA0101/NS5ATP9/PAF/p15(PAF) is involved in protection of cells from UV-induced cell death and is also a Hepatitis C NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCNA associated factor Antibody (H00009768-M01)(10)

Publications using H00009768-M01

• Anchalee T, Ravat P, Pattana S et al. PCNA-associated factor (KIAA0101/PCLAF) overexpression and gene copy number alterations in hepatocellular carcinoma tissues. BMC Cancer. 2021-03-20 [PMID: 33743635]
• He C, Jing Z, Yinan Y et al. Overexpression of KIAA0101 Promotes the Progression of Non-small Cell Lung Cancer. J Cancer. 2020-09-23 [PMID: 33046987]
• Tuanhe S, Qi A, Rong Y et al. MicroRNA-216a-5p suppresses esophageal squamous cell carcinoma progression by targeting KIAA0101. Oncol Rep. 2020-09-04 [PMID: 32901882]
• DST Ong, B Hu, YW Ho, CG Sauvé, CA Bristow, Q Wang, AS Multani, P Chen, L Nezi, S Jiang, CE Gorman, MM Monasterio, D Koul, M Marchesini, S Colla, EJ Jin, EP Sulman, DJ Spring, WA Yung, RGW Verhaak, L Chin, YA Wang, RA DePinho PAF promotes stemness and radioresistance of glioma stem cells Proc. Natl. Acad. Sci. U.S.A., 2017-10-09;114(43):E9086-E9095. 2017-10-09 [PMID: 29073105]
• Yuan D, Zhu K, Dang C et al. NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer. Med Oncol. 2014-07-05 [PMID: 24996800]
• Cheng Y, Li K, Diao D et al. Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro. Lab Invest. 2013-10-21 [PMID: 24145239]
• Chang CN, Feng MJ, Chen YL et al. p15PAF Is an Rb/E2F-Regulated S-Phase Protein Essential for DNA Synthesis and Cell Cycle Progression. PLoS One. 2013-04-04 [PMID: 23593430]
• Shubbar E, Kovacs A, Hajizadeh S et al. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. BMC Cancer 2013-01-02 [PMID: 23282137] (IF/IHC, Human)
• Kato T, Daigo Y, Aragaki M et al. Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients. Lung Cancer. 2011-06-18 [PMID: 21689861]
• Yuan RH, Jeng YM, Pan HW et al. Overexpression of KIAA0101 Predicts High Stage, Early Tumor Recurrence, Poor Prognosis of Hepatocellular Carcinoma. Clin Cancer Res;13(18):5368-76. 2007-09-15 [PMID: 17875765]

Bioinformatics

• Gene Symbol: PCLAF
• Entrez:
  • 9768(Human)
• Uniprot:
  • AAH05832(Human)