PCGF1 Antibody - Azide and BSA Free

Western Blot: PCGF1 Antibody [NBP3-16635] - Western blot analysis of extracts of various cell lines, using PCGF1 antibody (NBP3-16635) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: PCGF1 Antibody - Azide and BSA Free [NBP3-16635] - Immunofluorescence analysis of U-2OS cells using PCGF1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PCGF1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PCGF1 Antibody - Azide and BSA Free (NBP3-16635) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2). AHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCGF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PCGF1 Antibody - Azide and BSA Free

• MGC10882
• Nervous system Polycomb-1
• NSPc1
• NSPC1FLJ43754
• polycomb group ring finger 1,2010002K04Rik
• polycomb group RING finger protein 1
• RING finger protein 68
• RNF68RNF3A-2

Background

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors toregulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 (PubMed 11287196)). See alsoPCGF2 (MIM 600346).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCGF1