PCGF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCGF1 Antibody [NBP1-82767] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PCGF1 Antibody [NBP1-82767] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCGF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCGF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCGF1 Protein (NBP1-82767PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCGF1 Antibody

  • MGC10882
  • Nervous system Polycomb-1
  • NSPc1
  • NSPC1FLJ43754
  • polycomb group ring finger 1,2010002K04Rik
  • polycomb group RING finger protein 1
  • RING finger protein 68
  • RNF68RNF3A-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-14954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
AF4695
Species: Hu
Applications: WB, IHC, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1280
Species: Hu, Mu, Po, Bv, Ca
Applications: ChIP, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PCGF1 Antibody (NBP1-82767) (0)

There are no publications for PCGF1 Antibody (NBP1-82767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCGF1 Antibody (NBP1-82767) (0)

There are no reviews for PCGF1 Antibody (NBP1-82767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCGF1 Antibody (NBP1-82767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCGF1 Products

Bioinformatics Tool for PCGF1 Antibody (NBP1-82767)

Discover related pathways, diseases and genes to PCGF1 Antibody (NBP1-82767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCGF1 Antibody (NBP1-82767)

Discover more about diseases related to PCGF1 Antibody (NBP1-82767).
 

Pathways for PCGF1 Antibody (NBP1-82767)

View related products by pathway.

PTMs for PCGF1 Antibody (NBP1-82767)

Learn more about PTMs related to PCGF1 Antibody (NBP1-82767).
 

Research Areas for PCGF1 Antibody (NBP1-82767)

Find related products by research area.

Blogs on PCGF1

There are no specific blogs for PCGF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCGF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCGF1