PCBP2 Recombinant Protein Antigen

Images

 
There are currently no images for PCBP2 Protein (NBP1-83241PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PCBP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCBP2.

Source: E. coli

Amino Acid Sequence: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PCBP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83241.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCBP2 Recombinant Protein Antigen

  • alpha-CP2
  • Heterogeneous nuclear ribonucleoprotein E2
  • heterogenous nuclear ribonucleoprotein E2
  • hnRNP E2
  • hnRNP-E2
  • HNRPE2
  • MGC110998
  • poly(rC) binding protein 2
  • poly(rC)-binding protein 2

Background

PCBP2 is encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only three have been characterized to date.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005093-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-24531
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB110-40424
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF7094
Species: Hu
Applications: IHC
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77275
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB100-1020
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
H00006428-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-83241PEP
Species: Hu
Applications: AC

Publications for PCBP2 Protein (NBP1-83241PEP) (0)

There are no publications for PCBP2 Protein (NBP1-83241PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCBP2 Protein (NBP1-83241PEP) (0)

There are no reviews for PCBP2 Protein (NBP1-83241PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PCBP2 Protein (NBP1-83241PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCBP2 Products

Blogs on PCBP2

There are no specific blogs for PCBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCBP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBP2