PAX9 Antibody

Images

 
Western Blot: PAX9 Antibody [H00005083-B01P] - Analysis of PAX9 expression in human liver.
Western Blot: PAX9 Antibody [H00005083-B01P] - Analysis of PAX9 expression in transfected 293T cell line by PAX9 polyclonal antibody. Lane 1: PAX9 transfected lysate(37.51 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PAX9 Antibody Summary

Immunogen
PAX9 (NP_006185.1, 1 a.a. - 341 a.a.) full-length human protein. MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PAX9
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAX9 Antibody

  • paired box 9
  • paired box gene 9
  • paired box protein Pax-9
  • paired domain gene 9
  • Pax9
  • STHAG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-04309
Species: Hu
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF3287
Species: Hu, Mu, Rt
Applications: WB
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
46780002
Species: Hu
Applications: ELISA
AF922
Species: Hu
Applications: WB, Block
355-BM/CF
Species: Hu, Mu, Rt
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB100-97821
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PAX9 Antibody (H00005083-B01P) (0)

There are no publications for PAX9 Antibody (H00005083-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAX9 Antibody (H00005083-B01P) (0)

There are no reviews for PAX9 Antibody (H00005083-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAX9 Antibody (H00005083-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAX9 Products

Bioinformatics Tool for PAX9 Antibody (H00005083-B01P)

Discover related pathways, diseases and genes to PAX9 Antibody (H00005083-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAX9 Antibody (H00005083-B01P)

Discover more about diseases related to PAX9 Antibody (H00005083-B01P).
 

Pathways for PAX9 Antibody (H00005083-B01P)

View related products by pathway.

PTMs for PAX9 Antibody (H00005083-B01P)

Learn more about PTMs related to PAX9 Antibody (H00005083-B01P).
 

Research Areas for PAX9 Antibody (H00005083-B01P)

Find related products by research area.

Blogs on PAX9

There are no specific blogs for PAX9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAX9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX9
Entrez
Uniprot