Pax7 Partial Protein

Images

 
SDS-Page: Pax7 Partial Protein [H00005081-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Pax7 Partial Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 411 - 520 of Human PAX7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Protein
Gene
PAX7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax7 Partial Protein

  • FLJ37460
  • HUP1
  • paired box 7
  • paired box gene 7
  • paired box homeotic gene 7
  • paired box protein Pax-7
  • paired domain gene 7
  • PAX7 transcriptional factor
  • Pax7
  • PAX7B
  • RMS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31216
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00005081-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no publications for Pax7 Partial Recombinant Protein (H00005081-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no reviews for Pax7 Partial Recombinant Protein (H00005081-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pax7 Products

Bioinformatics Tool for Pax7 Partial Recombinant Protein (H00005081-Q01)

Discover related pathways, diseases and genes to Pax7 Partial Recombinant Protein (H00005081-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax7 Partial Recombinant Protein (H00005081-Q01)

Discover more about diseases related to Pax7 Partial Recombinant Protein (H00005081-Q01).
 

Pathways for Pax7 Partial Recombinant Protein (H00005081-Q01)

View related products by pathway.

PTMs for Pax7 Partial Recombinant Protein (H00005081-Q01)

Learn more about PTMs related to Pax7 Partial Recombinant Protein (H00005081-Q01).
 

Research Areas for Pax7 Partial Recombinant Protein (H00005081-Q01)

Find related products by research area.

Blogs on Pax7

There are no specific blogs for Pax7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax7 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX7
Entrez