Pax5/BSAP Antibody

Images

 
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Paraffin-embedded alcohol fixed rat spleen tissue (40x). Antigen retrieval pH9. PAX5 dilution 1:500 overnight at 4C. IHC-P image submitted by a verified ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Rt, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Pax5/BSAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Specificity
Specificity of human Pax5/BSAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
Pax5/BSAP Protein (NBP2-38790PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38790 in the following applications:

Publications
Read Publication using
NBP2-38790 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Use in Rat reported in secitific publication PMID: 32622430

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pax5/BSAP Antibody

  • B cell specific activator protein
  • B-cell-specific transcription factor
  • BSAP
  • BSAPB-cell lineage specific activator
  • paired box 5
  • paired box gene 5 (B-cell lineage specific activator protein)
  • paired box gene 5 (B-cell lineage specific activator)
  • paired box homeotic gene 5
  • paired box protein Pax-5
  • Pax5
  • transcription factor PAX 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001879-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB7650
Species: Mu
Applications: WB, IHC
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ma, Gt, Gp, Pm, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-67309
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-38790
Species: Hu, Rt, Mu, Rt
Applications: IHC, IHC-P

Publications for Pax5/BSAP Antibody (NBP2-38790)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Review for Pax5/BSAP Antibody (NBP2-38790) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP2-38790:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Pax5/BSAP NBP2-38790
Enlarge
5
reviewed by:
Anonymous
IHC-P Rat 02/17/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSpleen tissue
SpeciesRat
LotR75047

Comments

CommentsParaffin-embedded alcohol fixed tissue. Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4°C.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pax5/BSAP Antibody (NBP2-38790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pax5/BSAP Products

Bioinformatics Tool for Pax5/BSAP Antibody (NBP2-38790)

Discover related pathways, diseases and genes to Pax5/BSAP Antibody (NBP2-38790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax5/BSAP Antibody (NBP2-38790)

Discover more about diseases related to Pax5/BSAP Antibody (NBP2-38790).
 

Pathways for Pax5/BSAP Antibody (NBP2-38790)

View related products by pathway.

PTMs for Pax5/BSAP Antibody (NBP2-38790)

Learn more about PTMs related to Pax5/BSAP Antibody (NBP2-38790).
 

Research Areas for Pax5/BSAP Antibody (NBP2-38790)

Find related products by research area.

Blogs on Pax5/BSAP

There are no specific blogs for Pax5/BSAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
02/17/2018
Application: IHC-P
Species: Rat

Bioinformatics

Gene Symbol PAX5
Uniprot