Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL |
Specificity | Specificity of human Pax5/BSAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PAX5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-38790 | Applications | Species |
---|---|---|
Tibaldi E, Gnudi F, Panzacchi S et al. Identification of aspartame-induced haematopoietic and lymphoid tumours in rats after lifetime treatment Acta Histochemica Jan 1 2020 [PMID: 32622430] (IHC, Rat) | IHC | Rat |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
IHC-P | Rat | 02/17/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Pax5/BSAP Antibody (NBP2-38790)Discover more about diseases related to Pax5/BSAP Antibody (NBP2-38790).
| Pathways for Pax5/BSAP Antibody (NBP2-38790)View related products by pathway.
|
PTMs for Pax5/BSAP Antibody (NBP2-38790)Learn more about PTMs related to Pax5/BSAP Antibody (NBP2-38790).
| Research Areas for Pax5/BSAP Antibody (NBP2-38790)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.