Home » Pax5/BSAP » Pax5/BSAP Antibodies » Pax5/BSAP Antibody

Pax5/BSAP Antibody

 (1 Publication)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Paraffin-embedded alcohol fixed rat spleen tissue (40x). Antigen retrieval pH9. PAX5 dilution 1:500 overnight at 4C. IHC-P image submitted by a verified ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Rt, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Pax5/BSAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Specificity
Specificity of human Pax5/BSAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
Pax5/BSAP Protein (NBP2-38790PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38790 in the following applications:
Publications
Read Publication using
NBP2-38790 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Use in Rat reported in secitific publication PMID: 32622430

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pax5/BSAP Antibody

  • B cell specific activator protein
  • B-cell-specific transcription factor
  • BSAP
  • BSAPB-cell lineage specific activator
  • paired box 5
  • paired box gene 5 (B-cell lineage specific activator protein)
  • paired box gene 5 (B-cell lineage specific activator)
  • paired box homeotic gene 5
  • paired box protein Pax-5
  • Pax5
  • transcription factor PAX 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EBF-1 Antibody
(1G8)
H00001879-M02
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 expression in transfected 293T cell line by EBF1 monoclonal antibody (M02), clone 1G8.Lane 1: EBF1 transfected lysate(64 KDa).Lane 2: Non-transfected lysate.
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 over-expressed 293 cell line, cotransfected with EBF1 Validated Chimera RNAi ( Cat # H00001879-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EBF1 monoclonal antibody (M02), clone 1G8 (Cat # H00001879-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: EBF-1 Antibody (1G8) [H00001879-M02] - Detection limit for recombinant GST tagged EBF1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
CD19 Antibody
(CB19)
NBP2-25196
Immunocytochemistry/Immunofluorescence: CD19 Antibody (CB19) [NBP2-25196] - The CD19 (CB19) antibody was tested in Daudi cells at a 1:40 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - A surface stain was performed on Ramos cells with CD19 Antibody (CB19) NBP2-26646 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Surface staining of 10^6 human lymphocytes using 0.2 ug of CD19 antibody (red) and isotype control (green). Cell surface staining kit was used for this test.
(10 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
BLIMP1/PRDM1
Antibody (3H2-E8)
NB600-235
Western Blot: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - The effect of IL-21 and CD40L exposure on MEC1 and MEC2 cells. Expression of EBNA-2 and LMP-1 in IL-21 treated cells. Expression of EBNA-2, LMP-1 and Blimp-1 by immunoblotting; positive control: CBM1-Ral-STO, negative control: Ramos. 1.5x105 cells were loaded in the control lanes and 5x105 were loaded in both untreated and IL-21 treated MEC1 and MEC2 lanes. Note low expression of EBNA-2 and high expression of LMP-1 after IL-21 treatment and induction of Blimp-1 after IL-21 treatment. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0106008), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BLIMP1 (3H2-E8) at 10 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Analysis using paraffin-embedded human tonsil tissue with BLIMP1/PRDM1 antibody at dilution of 1:50. Detection is completed through VC001 (DAB) and Counterstained by hematoxylin; labeling is predominantly in germinal centers. Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(49 Publications)
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TCF-3/E2A Antibody
(826927)
MAB7650
Western blot shows lysates of D3 mouse embryonic stem cell line and P19 mouse embryonal carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for TCF‑3/E2A at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TCF‑3/E2A was detected in immersion fixed frozen sections of E9.5 mouse embryo using Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to branchial arch nuclei. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Mu
Applications: WB, IHC
CD79A Antibody
(HM57)
NB100-64347
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ma, Gt, Gp, Pm, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CD20 Antibody (L26)
NBP2-44743
Western Blot: CD20 Antibody (L26) [NBP2-44743] - Western Blot Analysis of Raji cell lysate using CD20 Mouse Monoclonal Antibody (L26).
Immunocytochemistry/Immunofluorescence: CD20 Antibody (L26) [NBP2-44743] - Immunofluorescence staining of Raji cells using CD20 Mouse Monoclonal Antibody (L26) followed by goat anti-Mouse IgG conjugated to CF488 (green). Nuclei are stained with Reddot.
Immunohistochemistry-Paraffin: MS4A1/CD20 Antibody (L26) [NBP2-44743] - Human Lymphoma stained with CD20 Monoclonal Antibody (L26)
(1 Publication)
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
(1 Review)
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Western Blot: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of Cytokeratin 20 on different cell lysates using anti-Cytokeratin 20 antibody at 1/1,000 dilution. Positive control: Lane 1: Lovo Lane 2: HCT116 Lane 3: CRC
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded rat small intestine tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Bcl-6 Antibody
NBP2-59786
Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human lymphoma, non-Hodgkin's type, shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human tonsil shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Osteocalcin
Antibody (190125)
MAB1419
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(23 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
IL-7 [Unconjugated]
207-IL
IL-7 [Unconjugated]
(8 Reviews)
(129 Publications)
Species: Hu
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6)
NB300-164
Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.
Western Blot: Bestrophin 1 Antibody (E6-6) [NB300-164] - Western blot analysis of the normal and mutant human Best1 protein in transiently transfected MDCK cells. Best1 proteins are detectable as a 68 kDa band in all transfected cells, but not in non-transfected controls (MDCK lane). Actin bands are shown to indicate equal loading of cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/14/7/15121), licensed under a CC-BY licence.
(1 Review)
(39 Publications)
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
OCT2 Antibody
(Oct2/2137)
NBP2-75734
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis (A) Recombinant Protein (B) Daudi cell lysate Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Immunohistochemistry-Paraffin: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Formalin-fixed, paraffin-embedded human Tonsil stained with Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis Ramos cell lysate using Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
CD45 Antibody
(30-F11)
NB100-77417
Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse (Balb C) splenocytes (1x10^6) were stained with [NB100-77417] at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Analysis of FFPE section of mouse spleen using rat monoclonal CD45 antibody (30-F11) [NB100-77417] at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section.
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. Image submitted via verified customer review.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Pax5/BSAP Antibody
NBP2-38790
Pax5/BSAP Antibody
Species: Hu, Rt, Mu, Rt
Applications: IHC, IHC-P

Publications for Pax5/BSAP Antibody (NBP2-38790)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Review for Pax5/BSAP Antibody (NBP2-38790) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP2-38790:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Pax5/BSAP NBP2-38790
Enlarge 		5
reviewed by:
Anonymous
 IHC-P Rat 02/17/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSpleen tissue
SpeciesRat
LotR75047

Comments

CommentsParaffin-embedded alcohol fixed tissue. Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4°C.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pax5/BSAP Antibody (NBP2-38790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Pax5/BSAP Products

Bioinformatics Tool for Pax5/BSAP Antibody (NBP2-38790)

Discover related pathways, diseases and genes to Pax5/BSAP Antibody (NBP2-38790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax5/BSAP Antibody (NBP2-38790)

Discover more about diseases related to Pax5/BSAP Antibody (NBP2-38790).
 

Pathways for Pax5/BSAP Antibody (NBP2-38790)

View related products by pathway.

PTMs for Pax5/BSAP Antibody (NBP2-38790)

Learn more about PTMs related to Pax5/BSAP Antibody (NBP2-38790).
 

Research Areas for Pax5/BSAP Antibody (NBP2-38790)

Find related products by research area.

Blogs on Pax5/BSAP

There are no specific blogs for Pax5/BSAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin Pax5/BSAP NBP2-38790
Enlarge
 Anonymous
02/17/2018
Application: IHC-P
Species: Rat
read this review

Bioinformatics

Gene Symbol PAX5
Uniprot