Pax5/BSAP Antibody - BSA Free

Analysis in human tonsil tissue.

• Reactivity: Hu, Rt, Ha, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pax5/BSAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pax5/BSAP Antibody - BSA Free (NBP2-38790) is a polyclonal antibody validated for use in IHC and WB. Anti-Pax5/BSAP Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAX5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin Reactivity reported in (PMID:35982658)
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  Pax5/BSAP Protein (NBP2-38790PEP)

Reactivity Notes

Use in Hamster reported in scientific literature (PMID:34159329). Use in Rat reported in scientific publication (PMID: 32622430).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pax5/BSAP Antibody - BSA Free

• B cell specific activator protein
• B-cell-specific transcription factor
• BSAP
• BSAPB-cell lineage specific activator
• paired box 5
• paired box gene 5 (B-cell lineage specific activator protein)
• paired box gene 5 (B-cell lineage specific activator)
• paired box homeotic gene 5
• paired box protein Pax-5
• Pax5
• transcription factor PAX 5

Background

PAX5 encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pax5/BSAP Antibody (NBP2-38790)(5)

Publications using NBP2-38790

• Port JR, Yinda CK, Riopelle JC et al. Infection- or AZD1222 vaccine-mediated immunity reduces SARS-CoV-2 transmission but increases Omicron competitiveness in hamsters Nature communications 2023-10-18 [PMID: 37852960] (Hamster)
  
  Details:
  Dilution 1:500
• Port JR, Yinda CK, Riopelle JC et al. Infection- or vaccine mediated immunity reduces SARS-CoV-2 transmission, but increases competitiveness of Omicron in hamsters bioRxiv : the preprint server for biology 2022-07-29 [PMID: 35982658] (IHC-P, Hamster)
  
  Details:
  Dilution used for IHC 1:500
• Port JR, Adney DR, Schwarz B et al. High-Fat High-Sugar Diet-Induced Changes in the Lipid Metabolism Are Associated with Mildly Increased COVID-19 Severity and Delayed Recovery in the Syrian Hamster Viruses 2021-12-14 [PMID: 34960775] (IF/IHC, Hamster)
• Port JR, Adney DR, Schwarz B et al. Western diet increases COVID-19 disease severity in the Syrian hamster bioRxiv : the preprint server for biology 2021-06-17 [PMID: 34159329] (IF/IHC, Hamster)
• Tibaldi E, Gnudi F, Panzacchi S et al. Identification of aspartame-induced haematopoietic and lymphoid tumours in rats after lifetime treatment Acta Histochemica 2020-01-01 [PMID: 32622430] (IF/IHC, Rat)

Review for Pax5/BSAP Antibody (NBP2-38790) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer IHC-P Rat 02/17/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Spleen tissue
• Species: Rat
• Lot: R75047

Comments

• Comments: Paraffin-embedded alcohol fixed tissue. Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4°C.

Bioinformatics

• Gene Symbol: PAX5
• Uniprot:
  • Q02548()