Home » Pax5/BSAP » Pax5/BSAP Antibodies » Pax5/BSAP Antibody

Pax5/BSAP Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Rt, Ha, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Pax5/BSAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-P,Retrieval method: HIER pH6.
Control Peptide
Pax5/BSAP Protein (NBP2-38790PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38790 in the following applications:
Publications
Read Publications using
NBP2-38790 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Use in Hamster reported in scientific literature (PMID:34159329). Use in Rat reported in scientific publication (PMID: 32622430).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pax5/BSAP Antibody

  • B cell specific activator protein
  • B-cell-specific transcription factor
  • BSAP
  • BSAPB-cell lineage specific activator
  • paired box 5
  • paired box gene 5 (B-cell lineage specific activator protein)
  • paired box gene 5 (B-cell lineage specific activator)
  • paired box homeotic gene 5
  • paired box protein Pax-5
  • Pax5
  • transcription factor PAX 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EBF-1 Antibody
(1G8)
H00001879-M02
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 expression in transfected 293T cell line by EBF1 monoclonal antibody (M02), clone 1G8.Lane 1: EBF1 transfected lysate(64 KDa).Lane 2: Non-transfected lysate.
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 over-expressed 293 cell line, cotransfected with EBF1 Validated Chimera RNAi ( Cat # H00001879-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EBF1 monoclonal antibody (M02), clone 1G8 (Cat # H00001879-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: EBF-1 Antibody (1G8) [H00001879-M02] - Detection limit for recombinant GST tagged EBF1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, IP, KD, S-ELISA, WB
CD19 Antibody
(CB19)
NBP2-25196
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the FITC conjugate of NBP2-25196. Staining of CD19 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD19 antibody.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the PE conjugate of NBP2-25196. Staining of CD19 in 1x10^6 human PBMC using 10 ul (0.25 ug) of was used to test this product. Propidium iodide negative lymphocyte population gated for analysis.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the Alexa Fluor (R) 700 conjugate of NBP2-25196. Staining of human PBMC. Image from verified customer review.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
BLIMP1/PRDM1
Antibody (3H2-E8)
NB600-235
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-BLIMP1/PRDM1 (3H2-E8) conjugated to DyLight 550 [NB600-235R] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Analysis using the Biotin conjugate of NB600-235. Staining of Blimp-1 in mouse spleen. Image courtesy of product review by Branislav Krljanac.
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BLIMP1 (3H2-E8) at 10 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(50 Publications)
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TCF-3/E2A Antibody
(826927)
MAB7650
Western blot shows lysates of D3 mouse embryonic stem cell line and P19 mouse embryonal carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for TCF‑3/E2A at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TCF‑3/E2A was detected in immersion fixed frozen sections of E9.5 mouse embryo using Rat Anti-Mouse TCF‑3/E2A Monoclonal Antibody (Catalog # MAB7650) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to branchial arch nuclei. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Publications)
Species: Mu
Applications: IHC, WB
CD79A Antibody
(HM57)
NB100-64347
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
(2 Publications)
Species: Bv, Ca, Ch, Eq, Ma, Gt, Gp, Hu, Pm, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
(1 Review)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of CRC cells with Cytokeratin 20 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded human colon cancer tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Bcl-6 Antibody
NBP2-59786
Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining in human tonsil and pancreas tissues . Corresponding BCL6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Osteocalcin
Antibody (190125)
MAB1419
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(25 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-7 [Unconjugated]
207-IL/CF
Recombinant Human IL-7 (207-IL/CF) stimulates proliferation of PHA-activated human peripheral blood lymphocytes in a dose-dependent manner. The ED50 for this effect is 0.1-0.5 ng/mL.
(142 Publications)
Species: Hu
Applications: BA
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6)
NB300-164
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin-embedded sections of human brain using Mouse Anti-Human Bestrophin 1 (E6-6) Monoclonal Antibody (Catalog # NB300-164) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in neurons.
Immunohistochemistry-Paraffin: Bestrophin 1 Antibody (E6-6) [NB300-164] - Bestrophin 1 was detected in immersion fixed paraffin sections of human small intestine using t Mouse Anti-Human Bestrophin 1 Monoclonal Antibody (Catalog # NB300-164) at 5 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cell surface and extracellular.
Dual RNAscope ISH-IHC: Bestrophin 1 Antibody (E6-6) [NB300-164] - Formalin-fixed paraffin-embedded tissue sections of human duodenum were probed for Bestrophin 1 mRNA (ACD RNAScope Probe, catalog # 433181; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse anti-human (Novus Biologicals catalog # NB300-164) at 0.3ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). IHC signal is confined to cytoplasm.
(1 Review)
(45 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
OCT2 Antibody
(Oct2/2137)
NBP2-75734
Immunohistochemistry-Paraffin: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Formalin-fixed, paraffin-embedded human Lymph Node stained with Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Immunohistochemistry-Paraffin: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Formalin-fixed, paraffin-embedded human Tonsil stained with Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis Ramos cell lysate using Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB
CD45 Antibody
(30-F11)
NB100-77417
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. IHC-P image submitted by a verified customer review.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
(5 Reviews)
(34 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
NOD2 Antibody (2D9)
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Pax5/BSAP Antibody
NBP2-38790
Pax5/BSAP Antibody
Species: Hu, Rt, Ha, Mu
Applications: IHC, IHC-P

Publications for Pax5/BSAP Antibody (NBP2-38790)(2)

We have publications tested in 2 confirmed species: Rat, Hamster.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Rat
(1)
Hamster
(1)
All Species

Review for Pax5/BSAP Antibody (NBP2-38790) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP2-38790:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Pax5/BSAP NBP2-38790
Enlarge 		5
reviewed by:
Verified Customer
 IHC-P Rat 02/17/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSpleen tissue
SpeciesRat
LotR75047

Comments

CommentsParaffin-embedded alcohol fixed tissue. Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4°C.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pax5/BSAP Antibody (NBP2-38790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Pax5/BSAP Products

Bioinformatics Tool for Pax5/BSAP Antibody (NBP2-38790)

Discover related pathways, diseases and genes to Pax5/BSAP Antibody (NBP2-38790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax5/BSAP Antibody (NBP2-38790)

Discover more about diseases related to Pax5/BSAP Antibody (NBP2-38790).
 

Pathways for Pax5/BSAP Antibody (NBP2-38790)

View related products by pathway.

PTMs for Pax5/BSAP Antibody (NBP2-38790)

Learn more about PTMs related to Pax5/BSAP Antibody (NBP2-38790).
 

Research Areas for Pax5/BSAP Antibody (NBP2-38790)

Find related products by research area.

Blogs on Pax5/BSAP

There are no specific blogs for Pax5/BSAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin Pax5/BSAP NBP2-38790
Enlarge
 Verified Customer
02/17/2018
Application: IHC-P
Species: Rat
read this review

Bioinformatics

Gene Symbol PAX5
Uniprot