PAWR / PAR4 Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

PAWR / PAR4 Antibody [DyLight 650] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAWR / PAR4 (NP_002574.2)
  
  Sequence:
  QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAWR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for PAWR / PAR4 Antibody [DyLight 650]

• Par-4
• PAR4prostate apoptosis response protein 4
• PRKC apoptosis WT1 regulator protein
• PRKC, apoptosis, WT1, regulator
• Prostate apoptosis response 4 protein
• prostate apoptosis response protein PAR-4
• transcriptional repressor PAR4
• WT1-interacting protein

Background

The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAWR