PATJ Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PATJ Antibody [NBP2-55886] - Staining of human cell line A-431 shows localization to cytosol, microtubule organizing center & cell junctions. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PATJ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Specificity
Specificity of human PATJ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INADL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PATJ Recombinant Protein Antigen (NBP2-55886PEP)

Reactivity Notes

Mouse 89%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PATJ Antibody

  • channel-interacting PDZ domain protein
  • FLJ26982
  • hINADL
  • inactivation no after-potential D-like protein
  • Inadl protein
  • InaD-like (Drosophila)
  • inaD-like protein
  • InaD-like
  • Pals1-associated tight junction protein
  • PATJCipp
  • PDZ domain protein
  • Protein associated to tight junctions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80518
Species: Hu
Applications: WB
NBP2-49513
Species: Hu
Applications: IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14193
Species: Hu
Applications: IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55886
Species: Hu
Applications: ICC/IF

Publications for PATJ Antibody (NBP2-55886) (0)

There are no publications for PATJ Antibody (NBP2-55886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PATJ Antibody (NBP2-55886) (0)

There are no reviews for PATJ Antibody (NBP2-55886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PATJ Antibody (NBP2-55886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PATJ Products

Array NBP2-55886

Bioinformatics Tool for PATJ Antibody (NBP2-55886)

Discover related pathways, diseases and genes to PATJ Antibody (NBP2-55886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PATJ Antibody (NBP2-55886)

Discover more about diseases related to PATJ Antibody (NBP2-55886).
 

Pathways for PATJ Antibody (NBP2-55886)

View related products by pathway.

PTMs for PATJ Antibody (NBP2-55886)

Learn more about PTMs related to PATJ Antibody (NBP2-55886).
 

Research Areas for PATJ Antibody (NBP2-55886)

Find related products by research area.

Blogs on PATJ

There are no specific blogs for PATJ, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PATJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INADL