PATJ Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
INADL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PATJ Antibody - BSA Free
Background
The PATJ gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to th
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Publications for PATJ Antibody (NBP2-55886) (0)
There are no publications for PATJ Antibody (NBP2-55886).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PATJ Antibody (NBP2-55886) (0)
There are no reviews for PATJ Antibody (NBP2-55886).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PATJ Antibody (NBP2-55886) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PATJ Products
Research Areas for PATJ Antibody (NBP2-55886)
Find related products by research area.
|
Blogs on PATJ