PATJ Antibody

Images

 
Immunohistochemistry: PATJ Antibody [NBP2-49481] - Staining of human colon shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PATJ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI
Specificity
Specificity of human PATJ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INADL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PATJ Recombinant Protein Antigen (NBP2-49481PEP)

Reactivity Notes

Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PATJ Antibody

  • channel-interacting PDZ domain protein
  • FLJ26982
  • hINADL
  • inactivation no after-potential D-like protein
  • Inadl protein
  • InaD-like (Drosophila)
  • inaD-like protein
  • InaD-like
  • Pals1-associated tight junction protein
  • PATJCipp
  • PDZ domain protein
  • Protein associated to tight junctions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-81185
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58844
Species: Hu
Applications: ICC/IF
NBP2-49513
Species: Hu
Applications: IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PATJ Antibody (NBP2-49481) (0)

There are no publications for PATJ Antibody (NBP2-49481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PATJ Antibody (NBP2-49481) (0)

There are no reviews for PATJ Antibody (NBP2-49481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PATJ Antibody (NBP2-49481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PATJ Antibody (NBP2-49481)

Discover related pathways, diseases and genes to PATJ Antibody (NBP2-49481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PATJ Antibody (NBP2-49481)

Discover more about diseases related to PATJ Antibody (NBP2-49481).
 

Pathways for PATJ Antibody (NBP2-49481)

View related products by pathway.

PTMs for PATJ Antibody (NBP2-49481)

Learn more about PTMs related to PATJ Antibody (NBP2-49481).
 

Research Areas for PATJ Antibody (NBP2-49481)

Find related products by research area.

Blogs on PATJ

There are no specific blogs for PATJ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PATJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INADL