Patched 1/PTCH Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTCH1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Patched 1/PTCH Antibody - BSA Free
Background
Mutations of the human Patched tumor suppressor gene (PTCH) have been identified in individuals with the nevoid basal cell carcinoma syndrome (NBCCS) as well as in sporadic basal cell carcinomas and medulloblastomas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Mu
Applications: IHC, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ICC/IF
Publications for Patched 1/PTCH Antibody (NBP2-57927) (0)
There are no publications for Patched 1/PTCH Antibody (NBP2-57927).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Patched 1/PTCH Antibody (NBP2-57927) (0)
There are no reviews for Patched 1/PTCH Antibody (NBP2-57927).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Patched 1/PTCH Antibody (NBP2-57927). (Showing 1 - 1 of 1 FAQ).
-
I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
- NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.
Secondary Antibodies
| |
Isotype Controls
|
Additional Patched 1/PTCH Products
Research Areas for Patched 1/PTCH Antibody (NBP2-57927)
Find related products by research area.
|
Blogs on Patched 1/PTCH