Patched 1/PTCH Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Patched 1/PTCH Antibody [NBP2-57927] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Patched 1/PTCH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Patched 1/PTCH Antibody - BSA Free (NBP2-57927) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTCH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Patched 1/PTCH Recombinant Protein Antigen (NBP2-57927PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Patched 1/PTCH Antibody - BSA Free

• BCNS
• BCNSFLJ42602
• FLJ26746
• HPE7
• mes
• NBCCS
• patched (Drosophila) homolog
• Patched 1
• patched homolog (Drosophila)
• patched homolog 1 (Drosophila)
• patched homolog 1
• protein patched homolog 1
• PTC
• ptc1
• PTCH protein +12b
• PTCH protein +4'
• PTCH protein -10
• PTCH
• PTCH1
• PTCH11

Background

Mutations of the human Patched tumor suppressor gene (PTCH) have been identified in individuals with the nevoid basal cell carcinoma syndrome (NBCCS) as well as in sporadic basal cell carcinomas and medulloblastomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Patched 1/PTCH Antibody (NBP2-57927). (Showing 1 - 1 of 1 FAQ).

1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
   • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Bioinformatics

• Gene Symbol: PTCH1