PASD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PASD1 Antibody [NBP1-84346] - Immunofluorescent staining of human cell line PC-3 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PASD1 Antibody [NBP1-84346] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PASD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHGDSSAYENVKFIVNVRDICNEFPVVFSGLFSSHLCADFAACVPQEDRLYLVGNVCILRTQLLQQLYTSKAVSDEAVLTQDSDEEPFVGELSSSQGQRGHTSMKAVYVEPAAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PASD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PASD1 Protein (NBP1-84346PEP)
Publications
Read Publication using NBP1-84346.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PASD1 Antibody

  • CT63Cancer/testis antigen 63
  • OXTES1
  • OX-TES-1
  • PAS domain containing 1
  • PAS domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
MAB5018
Species: Hu
Applications: WB, IP
NBP1-03285
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5525
Species: Hu
Applications: WB, IHC
H00168400-D01P
Species: Hu
Applications: WB, ELISA
NBP1-85419
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB100-97821
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14921
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
NBP1-84346
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PASD1 Antibody (NBP1-84346)(1)

Reviews for PASD1 Antibody (NBP1-84346) (0)

There are no reviews for PASD1 Antibody (NBP1-84346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PASD1 Antibody (NBP1-84346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PASD1 Products

Bioinformatics Tool for PASD1 Antibody (NBP1-84346)

Discover related pathways, diseases and genes to PASD1 Antibody (NBP1-84346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PASD1 Antibody (NBP1-84346)

Discover more about diseases related to PASD1 Antibody (NBP1-84346).
 

Pathways for PASD1 Antibody (NBP1-84346)

View related products by pathway.

Blogs on PASD1

There are no specific blogs for PASD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PASD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PASD1