DDX43 Antibody (3G12) - Azide and BSA Free

Western Blot: DDX43 Antibody (3G12) [H00055510-M07] - Analysis of DDX43 expression in transfected 293T cell line by DDX43 monoclonal antibody (M07), clone 3G12. Lane 1: DDX43 transfected lysatE (72.9 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DDX43 Antibody (3G12) [H00055510-M07] - Analysis of monoclonal antibody to DDX43 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: DDX43 Antibody (3G12) [H00055510-M07] - Detection limit for recombinant GST tagged DDX43 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3G12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DDX43 Antibody (3G12) - Azide and BSA Free Summary

• Immunogen: DDX43 (NP_061135.1, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI
• Specificity: DDX43 - DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 (3G12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DDX43
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 10 ug/ml
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX43 Antibody (3G12) - Azide and BSA Free

• Cancer/testis antigen 13
• CT13DEAD-box protein 43
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
• DEAD box protein 43
• DKFZp434H2114
• EC 3.6.1
• EC 3.6.4.13
• HAGEDEAD box protein HAGE
• Helical antigen
• probable ATP-dependent RNA helicase DDX43

Background

The protein encoded by this gene is an ATP-dependent RNA helicase in the DEAD-box family and displays tumor-specific expression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX43 Antibody (H00055510-M07)(1)

Publication using H00055510-M07

• Lin J, Ma JC, Yang J et al. Arresting of miR-186 and releasing of H19 by DDX43 facilitate tumorigenesis and CML progression. Oncogene 2018-02-16 [PMID: 29449695]

Bioinformatics

• Gene Symbol: DDX43
• Entrez:
  • 55510(Human)
• Uniprot:
  • NP_061135(Human)