PARP7 Antibody

Images

 
Immunohistochemistry-Paraffin: PARP7 Antibody [NBP1-88026] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVYETTEFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIPARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PARP7 Protein (NBP1-88026PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARP7 Antibody

  • DDF1
  • DKFZP434J214
  • DKFZp686N0351
  • DKFZp686P1838
  • EC 2.4.2.30
  • FLJ40466
  • PARP-1
  • PARP-7
  • PARP7DKFZp434J214
  • pART14
  • Poly [ADP-ribose] polymerase 7
  • RM1
  • TCDD-inducible poly [ADP-ribose] polymerase
  • TCDD-inducible poly(ADP-ribose) polymerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-89230
Species: Hu
Applications: WB, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-04611
Species: Hu
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for PARP7 Antibody (NBP1-88026) (0)

There are no publications for PARP7 Antibody (NBP1-88026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP7 Antibody (NBP1-88026) (0)

There are no reviews for PARP7 Antibody (NBP1-88026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PARP7 Antibody (NBP1-88026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARP7 Products

Bioinformatics Tool for PARP7 Antibody (NBP1-88026)

Discover related pathways, diseases and genes to PARP7 Antibody (NBP1-88026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP7 Antibody (NBP1-88026)

Discover more about diseases related to PARP7 Antibody (NBP1-88026).
 

Pathways for PARP7 Antibody (NBP1-88026)

View related products by pathway.

PTMs for PARP7 Antibody (NBP1-88026)

Learn more about PTMs related to PARP7 Antibody (NBP1-88026).
 

Research Areas for PARP7 Antibody (NBP1-88026)

Find related products by research area.

Blogs on PARP7

There are no specific blogs for PARP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIPARP