Home » PARP10 » PARP10 Proteins » PARP10 Recombinant Protein Antigen

PARP10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PARP10 Recombinant Protein Antigen (NBP2-57056PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

PARP10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARP10.

Source: E.coli

Amino Acid Sequence: LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PARP10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57056 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PARP10 Recombinant Protein Antigen

  • EC 2.4.2.30
  • FLJ14464
  • PARP-10
  • poly (ADP-ribose) polymerase family, member 10
  • poly [ADP-ribose] polymerase 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(5 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(41 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with COL11A2 antibody [473] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: COL11A2 protein stained by COL11A2 antibody [473] diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human COL11A2-transfected 293T cells (N-terminal fragment of COL11A2 isoform 1) 12 % SDS-PAGE COL11A2 antibody [473] dilution: 1:5000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
p62/SQSTM1 Antibody
NBP1-48320
Western Blot: p62/SQSTM1 Antibody [NBP1-48320] - Cultured HeLa cells were treated with or without 50 uM chloriquine for 24 hours as indicated. Cell lysates were prepared and separated on a 12% gel by SDS-PAGE. Protein was transferred to PVDF membrane and blocked in 5% non-fat milk. The membrane was then probed with 1 ug/ml anti-p62/SQSMT1 in 1% milk and dectected with an anti-rabbit HRP secondary antibody using chemiluminescence. Note the upregulation of p62 (arrowhead) in response to chloroquine treatment and the blockage of autophagy.
Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody [NBP1-48320] - HeLa cells were treated overnight with 50uM CQ, then fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p628/SQSTM1 at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody [NBP1-48320] - Untreated HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p628/SQSTM1 at a 1:200 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(7 Reviews)
(45 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CDK2 Antibody (1A6)
NBP2-37507
Western Blot: CDK2 Antibody (1A6) [NBP2-37507] - Western blot analysis using CDK2 mouse mAb against Jurkat (1), HL-60 (2), K562(3), A431(4), HeLa(5), and NIH3T3 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: CDK2 Antibody (1A6) [NBP2-37507] - Immunofluorescence analysis of HeLa cells using CDK2 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: CDK2 Antibody (1A6) [NBP2-37507] - Immunohistochemical analysis of paraffin-embedded colon cancer tissues using CDK2 mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Max Antibody
(4E1.0-1A9)
H00004149-M01
Immunocytochemistry/Immunofluorescence: Max Antibody (4E10-1A9) [H00004149-M01] - Analysis of monoclonal antibody to MAX on HeLa cell. Antibody concentration 10 ug/ml.
Proximity Ligation Assay: Max Antibody (4E10-1A9) [H00004149-M01] - Analysis of protein-protein interactions between MAPK14 and MAX. HeLa cells were stained with anti-MAPK14 rabbit purified polyclonal 1:1200 and anti-MAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
ELISA: Max Antibody (4E1.0-1A9) [H00004149-M01] - Max Antibody (4E10-1A9) [H00004149-M01] - Detection limit for recombinant GST tagged MAX is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta-actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - Beta-Actin expression in Fibroblast Hs68 cell lysate using anti-beta-Actin antibody. Image from verified customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(25 Reviews)
(335 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
Apolipoprotein
A-I/ApoA1 Antibody
NB600-609
Apolipoprotein A-I/ApoA1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
IMP2/IGF2BP2
Antibody (OTI3F9)
NBP2-02627
Western Blot: IGF2BP2 Antibody (3F9) [NBP2-02627] Analysis of extracts (35ug) from 9 different cell lines by using anti-IGF2BP2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY IGF2BP2.
Immunohistochemistry-Paraffin: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of paraffin-embedded Human liver tissue using anti-IGF2BP2 mouse monoclonal antibody.
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
dynactin 4
Antibody (3G9D7)
NBP2-37399
Western Blot: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Western blot analysis using DCTN4 mouse mAb against Raw264.7 (1) and NIH3T3 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunofluorescence analysis of HepG2 cells using DCTN4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues using DCTN4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Proprotein
Convertase 9/PCSK9 An
NBP2-31364
Western Blot: PCSK9 Antibody [NBP2-31364] - Western blot analysis of human lung tissue (A) using PCSK9 antibody at a concentration of 2 ug/ml.
Immunocytochemistry/Immunofluorescence: PCSK9 Antibody [NBP2-31364] - PCSK9 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). A concentration of 0.1 ug/ml was used. Image objective 40x.
Immunohistochemistry-Paraffin: PCSK9 Antibody [NBP2-31364] - IHC-P analysis of PCSK9 protein in a section of normal skin from human using 5 ug/ml concentration of PCSK9 antibody. The keratinocytes showed an expected cytoplasmic staining pattern with more intensity towards the cellular periphery, whereas the pigmented basel cell layer depicted relatively milder staining.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SAM68 Antibody
NBP1-19151
Western Blot: SAM68 Antibody [NBP1-19151] - Whole cell lysate from HeLa cells. SAM68 was also immunoprecipitated by rabbit anti-SAM68 antibodies NBP1-19152 and NBP1-19153.
Immunohistochemistry: SAM68 Antibody [NBP1-19151] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti- SAM68 used at a dilution of 1:1,000 (0.2 ug/ml). Detection: DAB
(1 Review)
(2 Publications)
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NUP62 Antibody
NBP1-31381
Western Blot: NUP62 Antibody [NBP1-31381] - Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and blotted with Nucleoporin p62 antibody diluted by 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Nucleoporin p62 Antibody [NBP1-31381] - Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Nucleoporin p62 protein stained by Nucleoporin p62 antibody diluted at 1:750. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Nucleoporin p62 Antibody [NBP1-31381] - Paraffin-embedded NCIN87 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
ART3 Antibody
NBP1-86479
Immunohistochemistry-Paraffin: ART3 Antibody [NBP1-86479] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: ART3 Antibody [NBP1-86479] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ART3 Antibody [NBP1-86479] - Staining in human testis and endometrium tissues using anti-ART3 antibody. Corresponding ART3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - GTF2H1 monoclonal antibody (M01), clone 1F12-1B5 Analysis of GTF2H1 expression in Jurkat.
Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on formalin-fixed paraffin-embedded human testis tissue.Antibody concentration 5 ug/ml.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Haptoglobin
Antibody (JM10-79)
NBP2-66881
Western Blot: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Analysis of Haptoglobin on different cells lysates using anti-Haptoglobin antibody at 1/500 dilution. Positive control: Lane 1: Hela Lane 2: HepG2
Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Analysis of paraffin-embedded mouse lung tissue using anti-Haptoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Nestin Antibody
(196908)
MAB1259
Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(57 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Plectin Antibody
NBP1-84020
Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84020] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human liver.
Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84020] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DLC1 Antibody
NBP1-88824
Western Blot: DLC1 Antibody [NBP1-88824] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: DLC1 Antibody [NBP1-88824] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: DLC1 Antibody [NBP1-88824] - Staining of human duodenum shows distinct positivity of microvilli in glandular cells.
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PARP4 Antibody
NBP1-89232
Western Blot: PARP4 Antibody [NBP1-89232] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PARP4 Antibody [NBP1-89232] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PARP4 Antibody [NBP1-89232] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)

There are no publications for PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)

There are no reviews for PARP10 Recombinant Protein Antigen (NBP2-57056PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-57056PEP

Bioinformatics Tool for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

Discover related pathways, diseases and genes to PARP10 Recombinant Protein Antigen (NBP2-57056PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

Discover more about diseases related to PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
 

Pathways for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

View related products by pathway.

PTMs for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

Learn more about PTMs related to PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
 

Research Areas for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)

Find related products by research area.

Blogs on PARP10

There are no specific blogs for PARP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta-actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.
beta-Actin Antibody (AC-15)
NB600-501
Western Blot: p62/SQSTM1 Antibody [NBP1-48320] - Cultured HeLa cells were treated with or without 50 uM chloriquine for 24 hours as indicated. Cell lysates were prepared and separated on a 12% gel by SDS-PAGE. Protein was transferred to PVDF membrane and blocked in 5% non-fat milk. The membrane was then probed with 1 ug/ml anti-p62/SQSMT1 in 1% milk and dectected with an anti-rabbit HRP secondary antibody using chemiluminescence. Note the upregulation of p62 (arrowhead) in response to chloroquine treatment and the blockage of autophagy.
p62/SQSTM1 Antibody
NBP1-48320

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PARP10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PARP10