PARP10 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARP10. Source: E.coli Amino Acid Sequence: LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PARP10 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-57056 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for PARP10 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA, IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Publications for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)
There are no publications for PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)
There are no reviews for PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PARP10 Recombinant Protein Antigen (NBP2-57056PEP) (0)
Other Available Formats
Additional PARP10 Products
Bioinformatics Tool for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)
Discover related pathways, diseases and genes to PARP10 Recombinant Protein Antigen (NBP2-57056PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)
Discover more about diseases related to PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
| | Pathways for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)
View related products by pathway.
|
PTMs for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)
Learn more about PTMs related to PARP10 Recombinant Protein Antigen (NBP2-57056PEP).
| | Research Areas for PARP10 Recombinant Protein Antigen (NBP2-57056PEP)
Find related products by research area.
|
Blogs on PARP10
![Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)---Cleaved-Western-Blot-NB100-56599-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)---Cleaved-Immunocytochemistry-Immunofluorescence-NB100-56599-img0005.jpg)
![Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.](http://images.novusbio.com/images2/PARP-Antibody-(194C1439)---Cleaved-Western-Blot-NB100-56599-img0003.jpg)
![Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/c-Myc-Antibody-Western-Blot-NB600-335-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.](http://images.novusbio.com/images2/c-Myc-Antibody-Immunocytochemistry-Immunofluorescence-NB600-335-img0007.jpg)
![Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).](http://images.novusbio.com/images2/c-Myc-Antibody-Western-Blot-NB600-335-img0005.jpg)
![Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with COL11A2 antibody [473] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.](http://images.novusbio.com/images2/Collagen-XI-alpha-2-Antibody-(473)-Western-Blot-NBP2-43728-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: COL11A2 protein stained by COL11A2 antibody [473] diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Collagen-XI-alpha-2-Antibody-(473)-Immunocytochemistry-Immunofluorescence-NBP2-43728-img0003.jpg)
![Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human COL11A2-transfected 293T cells (N-terminal fragment of COL11A2 isoform 1) 12 % SDS-PAGE COL11A2 antibody [473] dilution: 1:5000](http://images.novusbio.com/images2/Collagen-XI-alpha-2-Antibody-(473)-Western-Blot-NBP2-43728-img0002.jpg)
![Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - WB analysis of recombinant p62 protein (immunogen, 74.51 KDa) using SQSTM1/p62 antibody (clone 2C11).](http://images.novusbio.com/images2/p62-SQSTM1-Antibody-(2C11)-Western-Blot-H00008878-M01-img0012.jpg)
![Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - WB analysis of p62 in p62 WT and KO mouse hepatocytes and HepG2 cell lysate using anti-p62/SQSTM1 antibody clone 2C11. Sample lane1: p62 +/- mouse hepatocytes, lane 2: p62 -/- mouse hepatocytes, lane3: Wt mouse hepatocytes, lane 4: HepG2 cells. This image is from a verified customer product review.](http://images.novusbio.com/images2/p62-SQSTM1-Antibody-(2C11)-Western-Blot-H00008878-M01-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - ICC-IF analysis of SQSTM1 protein in HeLa cell using SQSTM1/p62 antibody (clone 2C11) at 10 ug/ml concentration.](http://images.novusbio.com/images2/p62-SQSTM1-Antibody-(2C11)-Immunocytochemistry-Immunofluorescence-H00008878-M01-img0008.jpg)
![Western Blot: Cdk2 Antibody (2D9) [NBP2-00776] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cdk2 monoclonal antibody.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Western Blot-NBP2-00776-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cdk2.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Immunocytochemistry-Immunofluorescence-NBP2-00776-img0007.jpg)
![Immunohistochemistry-Paraffin: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-Cdk2 mouse monoclonal antibody.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Immunohistochemistry-Paraffin-NBP2-00776-img0006.jpg)
![Western Blot: Max Antibody [NB100-793] - Staining of Jurkat lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Detected by chemiluminescence.](http://images.novusbio.com/images2/Max-Antibody-Western-Blot-NB100-793-img0002.jpg)
![Immunohistochemistry-Paraffin: Max Antibody [NB100-793] - Staining of Prostate. Antibody at 10 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/Max-Antibody-Immunohistochemistry-Paraffin-NB100-793-img0003.jpg)
![Immunofluorescence: Max Antibody [NB100-793] - Immunofluorescence analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/Max-Antibody-Immunofluorescence-NB100-793-img0004.jpg)
![Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta-actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.](http://images.novusbio.com/images2/beta-Actin-Antibody-(AC-15)-Western-Blot-NB600-501-img0023.jpg)
![Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.](http://images.novusbio.com/images2/beta-Actin-Antibody-(AC-15)-Simple-Western-NB600-501-img0028.jpg)
![Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - Beta-Actin expression in Fibroblast Hs68 cell lysate using anti-beta-Actin antibody. Image from verified customer review.](http://images.novusbio.com/images2/beta-Actin-Antibody-(AC-15)-Western-Blot-NB600-501-img0026.jpg)
![Western Blot: IGF2BP2 Antibody (3F9) [NBP2-02627] Analysis of extracts (35ug) from 9 different cell lines by using anti-IGF2BP2 monoclonal antibody.](http://images.novusbio.com/images/IGF2BP2 Antibody (3F9)-Western Blot-NBP2-02627-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY IGF2BP2.](http://images.novusbio.com/images/IGF2BP2 Antibody (3F9)-Immunocytochemistry-Immunofluorescence-NBP2-02627-img0009.jpg)
![Immunohistochemistry-Paraffin: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of paraffin-embedded Human liver tissue using anti-IGF2BP2 mouse monoclonal antibody.](http://images.novusbio.com/images/IGF2BP2 Antibody (3F9)-Immunohistochemistry-Paraffin-NBP2-02627-img0008.jpg)
![Western Blot: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Western blot analysis using DCTN4 mouse mAb against Raw264.7 (1) and NIH3T3 (2) cell lysate.](http://images.novusbio.com/images2/dynactin-4-Antibody-(3G9D7)-Western-Blot-NBP2-37399-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunofluorescence analysis of HepG2 cells using DCTN4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.](http://images.novusbio.com/images2/dynactin-4-Antibody-(3G9D7)-Immunocytochemistry-Immunofluorescence-NBP2-37399-img0005.jpg)
![Immunohistochemistry: dynactin 4 Antibody (3G9D7) [NBP2-37399] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues using DCTN4 mouse mAb with DAB staining.](http://images.novusbio.com/images2/dynactin-4-Antibody-(3G9D7)-Immunohistochemistry-NBP2-37399-img0008.jpg)
![Western Blot: SAM68 Antibody [NBP1-19151] - Whole cell lysate from HeLa cells. SAM68 was also immunoprecipitated by rabbit anti-SAM68 antibodies NBP1-19152 and NBP1-19153.](http://images.novusbio.com/images2/SAM68-Antibody-Western-Blot-NBP1-19151-img0010.jpg)
![Immunohistochemistry-Paraffin: SAM68 Antibody [NBP1-19151] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti- SAM68 used at a dilution of 1:1,000 (0.2 ug/ml). Detection: DAB](http://images.novusbio.com/images2/SAM68-Antibody-Immunohistochemistry-NBP1-19151-img0014.jpg)
![Western Blot: NUP62 Antibody [NBP1-31381] - Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and blotted with Nucleoporin p62 antibody diluted by 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/NUP62-Antibody-Western-Blot-NBP1-31381-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Nucleoporin p62 Antibody [NBP1-31381] - Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Nucleoporin p62 protein stained by Nucleoporin p62 antibody diluted at 1:750. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/images2/Nucleoporin-p62-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31381-img0012.jpg)
![Immunohistochemistry-Paraffin: Nucleoporin p62 Antibody [NBP1-31381] - Paraffin-embedded NCIN87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/Nucleoporin p62 Antibody-Immunohistochemistry-Paraffin-NBP1-31381-img0008.jpg)
![Immunohistochemistry-Paraffin: ART3 Antibody (3A2) [H00000419-M05] - Analysis of monoclonal antibody to ART3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 2 ug/ml](http://images.novusbio.com/images2/ART3-Antibody-(3A2)-Immunohistochemistry-Paraffin-H00000419-M05-img0003.jpg)
![ELISA: ART3 Antibody (3A2) [H00000419-M05] - Detection limit for recombinant GST tagged ART3 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/images2/ART3-Antibody-(3A2)-ELISA-H00000419-M05-img0002.jpg)
![Western Blot: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of GTF2H1 expression in transfected 293T cell line by GTF2H1 monoclonal antibody (M01), clone 1F12-1B5.Lane 1: GTF2H1 transfected lysate(62 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/GTF2H1-Antibody-(1F12-1B5)-Western-Blot-H00002965-M01-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/GTF2H1-Antibody-(1F12-1B5)-Immunocytochemistry-Immunofluorescence-H00002965-M01-img0009.jpg)
![Immunohistochemistry-Paraffin: GTF2H1 Antibody (1F12-1B5) [H00002965-M01] - Analysis of monoclonal antibody to GTF2H1 on formalin-fixed paraffin-embedded human testis tissue.Antibody concentration 5 ug/ml.](http://images.novusbio.com/images2/GTF2H1-Antibody-(1F12-1B5)-Immunohistochemistry-Paraffin-H00002965-M01-img0011.jpg)
![Western Blot: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Analysis of Haptoglobin on different cells lysates using anti-Haptoglobin antibody at 1/500 dilution. Positive control: Lane 1: Hela Lane 2: HepG2](http://images.novusbio.com/images2/Haptoglobin Antibody (JM10-79)-Western Blot-NBP2-66881-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Staining Haptoglobin in HepG2 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Haptoglobin-Antibody-(JM10-79)-Immunocytochemistry-Immunofluorescence-NBP2-66881-img0003.jpg)
![Immunohistochemistry-Paraffin: Haptoglobin Antibody (JM10-79) [NBP2-66881] - Analysis of paraffin-embedded mouse lung tissue using anti-Haptoglobin antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Haptoglobin-Antibody-(JM10-79)-Immunohistochemistry-Paraffin-NBP2-66881-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Plectin Antibody [NBP1-84019] - Staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments and focal adhesion sites. Antibody staining is shown in green.](http://images.novusbio.com/images2/Plectin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84019-img0011.jpg)
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/images2/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84019-img0017.jpg)
![Immunohistochemistry-Paraffin: Plectin Antibody [NBP1-84019] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/Plectin-Antibody-Immunohistochemistry-Paraffin-NBP1-84019-img0008.jpg)
![Immunohistochemistry-Paraffin: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Negative Control showing staining of paraffin embedded Mouse Adrenal Gland, with no primary antibody.](http://images.novusbio.com/images2/DLC1-Antibody---Isoform-1-and-3-Immunohistochemistry-Paraffin-NB300-917-img0008.jpg)
![Immunohistochemistry-Paraffin: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Staining of paraffin embedded Mouse Adrenal Gland. Antibody at 4 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.](http://images.novusbio.com/images2/DLC1-Antibody---Isoform-1-and-3-Immunohistochemistry-Paraffin-NB300-917-img0007.jpg)
![Immunofluorescence: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/DLC1-Antibody---Isoform-1-and-3-NB300-917-img0003.jpg)
![Western Blot: PARP4 Antibody [NBP1-06563] - Whole cell lysate from HeLa cells. vPARP was also immunoprecipitated by rabbit anti-vPARP antibody NBP1-06562, which recognizes an upstream epitope.](http://images.novusbio.com/images2/PARP4-Antibody-Western-Blot-NBP1-06563-img0005.jpg)
![Immunohistochemistry-Paraffin: PARP4 Antibody [NBP1-06563] - Human colon carcinoma. Antibody: Affinity purified rabbit anti- vPARP used at a dilution of 1:200 (1ug/ml). Detection: DAB](http://images.novusbio.com/images2/PARP4-Antibody-Immunohistochemistry-Paraffin-NBP1-06563-img0006.jpg)