PARN Antibody

Images

 
Western Blot: PARN Antibody [NBP1-84303] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PARN Antibody [NBP1-84303] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Western Blot: PARN Antibody [NBP1-84303] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PARN Protein (NBP1-84303PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARN Antibody

  • DANEC 3.1.13.4
  • Deadenylating nuclease
  • Deadenylation nuclease
  • poly(A)-specific ribonuclease (deadenylation nuclease)
  • poly(A)-specific ribonuclease PARN
  • Polyadenylate-specific ribonuclease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1075
Species: Hu
Applications: WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
355-BM/CF
Species: Hu, Mu, Rt
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84303
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PARN Antibody (NBP1-84303) (0)

There are no publications for PARN Antibody (NBP1-84303).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARN Antibody (NBP1-84303) (0)

There are no reviews for PARN Antibody (NBP1-84303). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARN Antibody (NBP1-84303) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARN Products

Bioinformatics Tool for PARN Antibody (NBP1-84303)

Discover related pathways, diseases and genes to PARN Antibody (NBP1-84303). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARN Antibody (NBP1-84303)

Discover more about diseases related to PARN Antibody (NBP1-84303).
 

Pathways for PARN Antibody (NBP1-84303)

View related products by pathway.

PTMs for PARN Antibody (NBP1-84303)

Learn more about PTMs related to PARN Antibody (NBP1-84303).

Blogs on PARN

There are no specific blogs for PARN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARN