Parkin Antibody

Western Blot: Parkin Antibody [H00005071-D01P] - Analysis of PARK2 expression in transfected 293T cell line by PARK2 polyclonal antibody.Lane 1: PARK2 transfected lysate(42.40 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Parkin Antibody [H00005071-D01P] - Analysis of protein-protein interactions between PARK2 and DLG1. HeLa cells were stained with anti-PARK2 rabbit purified polyclonal 1:1200 and anti-DLG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

Parkin Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PARK2 (AAH22014.1, 1 a.a. - 387 a.a.) full-length human protein. MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
• Specificity: PARK2 - Parkinson disease (autosomal recessive, juvenile) 2, parkin,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKN
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Parkin Antibody

• AR-JP
• E3 ubiquitin ligase
• E3 ubiquitin-protein ligase parkin
• EC 6.3.2.-
• LPRS2
• PARK2
• parkin 2
• Parkin
• Parkinson disease protein 2
• Parkinson juvenile disease protein 2
• parkinson protein 2, E3 ubiquitin protein ligase (parkin)
• PDJ
• PDJjuvenile) 2, parkin
• PRKN

Background

The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Parkin Antibody (H00005071-D01P)(2)

Publications using H00005071-D01P

• Scuderi Soraya, La Cognata Valentina, Drago Filippo et al. Alternative splicing generates different parkin protein isoforms: evidences in human, rat, and mouse brain. Biomed Res Int. 2014-07-16 [PMID: 25136611]
• La Cognata Valentina, Iemmolo Rosario, D'Agata Velia et al. Increasing the Coding Potential of Genomes Through Alternative Splicing: The Case of PARK2 Gene. Curr Genomics. 2014-06-01 [PMID: 24955028]

Bioinformatics

• Gene Symbol: PRKN
• Entrez:
  • 5071(Human)
• Uniprot:
  • AAH22014.1(Human)