PACRG Antibody - Azide and BSA Free

Western Blot: PACRG Antibody [H00135138-D01P] - Analysis of PACRG expression in mouse liver.

Western Blot: PACRG Antibody [H00135138-D01P] - Analysis of PACRG expression in human liver.

Western Blot: PACRG Antibody [H00135138-D01P] - Analysis of PACRG expression in transfected 293T cell line by PACRG polyclonal antibody.Lane 1: PACRG transfected lysate(29.30 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PACRG Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PACRG Antibody - Azide and BSA Free (H00135138-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PACRG (NP_001073847.1, 1 a.a. - 257 a.a.) full-length human protein. MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
• Specificity: Reacts with PARK2 co-regulated.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PACRG
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PACRG Antibody - Azide and BSA Free

• FLJ32724
• Glup
• HAK005771
• Molecular chaperone/chaperonin-binding protein
• PARK2 coregulated gene protein
• PARK2 co-regulated
• PARK2CRG
• parkin coregulated gene protein
• parkin co-regulated gene protein
• RP3-495O10.2

Background

This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy. The parkin co-regulated gene protein forms a large molecular complex with chaperones, including heat shock proteins 70 and 90, and chaperonin components. This protein is also a component of Lewy bodies in Parkinson's disease patients, and it suppresses unfolded Pael receptor-induced neuronal cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PACRG
• Entrez:
  • 135138(Human)
• Uniprot:
  • NP_001073847.1(Human)