PALMD Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PALMD Antibody [NBP1-88481] - Staining of human cell line RH-30 shows localization to nucleoplasm & actin filaments. Antibody staining is shown in green.

Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Staining of human liver shows moderate membranous positivity in hepatocytes.

Staining of human cerebral cortex shows no positivity in neurons.

Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Analysis in control (vector only transfected HEK293T lysate) and PALMD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PALMD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PALMD Antibody - BSA Free (NBP1-88481) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PALMD Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YDDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPGPNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PALMD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29511167). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PALMD Protein (NBP1-88481PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PALMD Antibody - BSA Free

• C1orf11
• palmdelphin
• PALMLFLJ20271
• Paralemnin-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PALMD Antibody (NBP1-88481)(2)

Publications using NBP1-88481

• Arnaud Chignon, Mickael Rosa, Marie-Chloé Boulanger, Déborah Argaud, Romain Devillers, Valentin Bon-Baret, Ghada Mkannez, Zhonglin Li, Anne Rufiange, Nathalie Gaudreault, David Gosselin, Sébastien Thériault, Yohan Bossé, Patrick Mathieu Enhancer-associated aortic valve stenosis risk locus 1p21.2 alters NFATC2 binding site and promotes fibrogenesis iScience 2021-02-27 [PMID: 33748722]
• Theriault S, Gaudreault N, Lamontagne M et al. A transcriptome-wide association study identifies PALMD as a susceptibility gene for calcific aortic valve stenosis. Nat Commun. 2018-03-07 [PMID: 29511167] (WB)

Bioinformatics

• Gene Symbol: PALMD