PALMD Antibody

Images

 
Western Blot: PALMD Antibody [NBP1-88481] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: PALMD Antibody [NBP1-88481] - Staining of human cell line RH-30 shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: PALMD Antibody [NBP1-88481] - Staining of human salivary gland shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PALMD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YDDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPGPNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALMD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PALMD Protein (NBP1-88481PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PALMD Antibody

  • C1orf11
  • palmdelphin
  • PALMLFLJ20271
  • Paralemnin-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
H00114299-M09
Species: Hu, Rt
Applications: WB, ELISA
NB100-61604
Species: Hu, Sh
Applications: WB (-), IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45492
Species: Hu
Applications: WB, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-30529
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PALMD Antibody (NBP1-88481) (0)

There are no publications for PALMD Antibody (NBP1-88481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PALMD Antibody (NBP1-88481) (0)

There are no reviews for PALMD Antibody (NBP1-88481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PALMD Antibody (NBP1-88481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PALMD Products

Bioinformatics Tool for PALMD Antibody (NBP1-88481)

Discover related pathways, diseases and genes to PALMD Antibody (NBP1-88481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PALMD Antibody (NBP1-88481)

Discover more about diseases related to PALMD Antibody (NBP1-88481).
 

Pathways for PALMD Antibody (NBP1-88481)

View related products by pathway.

PTMs for PALMD Antibody (NBP1-88481)

Learn more about PTMs related to PALMD Antibody (NBP1-88481).

Blogs on PALMD

There are no specific blogs for PALMD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PALMD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PALMD