PAQR8 Antibody - BSA Free

Western Blot: PAQR8 Antibody [NBP2-83357] - WB Suggested Anti-PAQR8 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PAQR8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PAQR8 Antibody - BSA Free (NBP2-83357) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAQR8. Peptide sequence: QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAQR8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PAQR8 Antibody - BSA Free

• C6orf33Lysosomal membrane protein in brain 1
• LMPB1FLJ32521
• lysosomal membrane protein in brain-1
• membrane progestin receptor beta
• mPR beta
• MPRBFLJ46206
• Progestin and adipoQ receptor family member 8
• progestin and adipoQ receptor family member VIIIchromosome 6 open reading frame 33

Background

Progestin Receptor Beta-extra recognizes the extracellular epitope of the membrane progestin receptor. Progestin receptors with are found in pituitary, reproductive tract and most estrogen receptor-containing brain regions; these receptors are inducible by estrogen treatment. There are also progestin receptor sites in brain areas lacking estrogen receptors, such as the cerebral cortex of the rat; these receptors are not induced by estradiol treatment. Nevertheless, such receptors resemble those induced by estradiol. Another inducer of progestin receptors in brain is testosterone, which works through its conversion to estradiol via aromatization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAQR8