PAQR8 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PAQR8 Antibody - BSA Free (NBP2-83357) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAQR8. Peptide sequence: QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PAQR8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PAQR8 Antibody - BSA Free
Background
Progestin Receptor Beta-extra recognizes the extracellular epitope of the membrane progestin receptor. Progestin receptors with are found in pituitary, reproductive tract and most estrogen receptor-containing brain regions; these receptors are inducible by estrogen treatment. There are also progestin receptor sites in brain areas lacking estrogen receptors, such as the cerebral cortex of the rat; these receptors are not induced by estradiol treatment. Nevertheless, such receptors resemble those induced by estradiol. Another inducer of progestin receptors in brain is testosterone, which works through its conversion to estradiol via aromatization.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Publications for PAQR8 Antibody (NBP2-83357) (0)
There are no publications for PAQR8 Antibody (NBP2-83357).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAQR8 Antibody (NBP2-83357) (0)
There are no reviews for PAQR8 Antibody (NBP2-83357).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAQR8 Antibody (NBP2-83357) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAQR8 Products
Research Areas for PAQR8 Antibody (NBP2-83357)
Find related products by research area.
|
Blogs on PAQR8