PAQR6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PAQR6 Antibody [NBP2-57962] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Western Blot: PAQR6 Antibody [NBP2-57962] - Analysis in human cell line RT-4.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAQR6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAQR6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 1:100 - 1:250
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PAQR6 Recombinant Protein Antigen (NBP2-57962PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAQR6 Antibody - BSA Free

• progestin and adipoQ receptor family member 6
• progestin and adipoQ receptor family member VIFLJ22672

Background

The PAQR6 gene encodes a progestin and adipoQ receptor family member 6 that exists in four isoforms: isoform 1 is 344 amino acids long at 37 kDA, isoform 2 is 351 amino acids long at 39 kDA, isoform 3 is 238 amino acids long at 25 kDA, and isoform 4 is 320 amino acids long at 35 kDA. PAQR6 interacts with genes CAP1, SCP2, and COL11A1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAQR6