PAPSS2 Antibody

Western Blot: PAPSS2 Antibody [NBP1-55135] - Human 721_B, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B.

Immunohistochemistry: PAPSS2 Antibody [NBP1-55135] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Tim

Western Blot: PAPSS2 Antibody [NBP1-55135] - 293T cells lysate, concentration 0.2-1 ug/ml.

Western Blot: PAPSS2 Antibody [NBP1-55135] - Human Hela, Antibody Dilution: 1.0 ug/ml PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Immunohistochemistry: PAPSS2 Antibody [NBP1-55135] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PAPSS2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PAPSS2(3'-phosphoadenosine 5'-phosphosulfate synthase 2) The peptide sequence was selected from the C terminal of PAPSS2. Peptide sequence PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAPSS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PAPSS2 and was validated on Western blot.
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAPSS2 Antibody

• 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• ATP sulfurylase/adenosine 5'-phosphosulfate kinase
• ATPSK2ATP sulfurylase/APS kinase 2
• bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
• EC 2.7.1.25
• PAPS synthase 2
• PAPS synthetase 2
• PAPSS 2
• SK 2
• SK2
• Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2

Background

Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAPSS2
• Uniprot:
  • O95340-2(Human)