PAP2 Antibody


Western Blot: PAP2 Antibody [NBP1-70670] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PAP2 Antibody Summary

Synthetic peptides corresponding to PAP2D(phosphatidic acid phosphatase type 2) The peptide sequence was selected from the N terminal of PAP2D. Peptide sequence FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PAP2D and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAP2 Antibody

  • lipid phosphate phosphatase-related protein type 5
  • phosphatidic acid phosphatase 2d
  • phosphatidic acid phosphatase type 2
  • PRG-5


PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.The protein encoded by this gene is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, IA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for PAP2 Antibody (NBP1-70670) (0)

There are no publications for PAP2 Antibody (NBP1-70670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAP2 Antibody (NBP1-70670) (0)

There are no reviews for PAP2 Antibody (NBP1-70670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAP2 Antibody (NBP1-70670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAP2 Products

PAP2 NBP1-70670

Bioinformatics Tool for PAP2 Antibody (NBP1-70670)

Discover related pathways, diseases and genes to PAP2 Antibody (NBP1-70670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PAP2

There are no specific blogs for PAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAP2 Antibody and receive a gift card or discount.


Gene Symbol LPPR5