PAOX Antibody


Western Blot: PAOX Antibody [NBP1-70668] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: PAOX Antibody [NBP1-70668] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PAOX Antibody Summary

Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the C terminal of PAOX. Peptide sequence GGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PAOX and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PAOX Antibody

  • DKFZp434J245
  • MGC45464
  • PAO
  • polyamine oxidase (exo-N4-amino)
  • polyamine oxidase


PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF

Publications for PAOX Antibody (NBP1-70668) (0)

There are no publications for PAOX Antibody (NBP1-70668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAOX Antibody (NBP1-70668) (0)

There are no reviews for PAOX Antibody (NBP1-70668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAOX Antibody (NBP1-70668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAOX Products

PAOX NBP1-70668

Bioinformatics Tool for PAOX Antibody (NBP1-70668)

Discover related pathways, diseases and genes to PAOX Antibody (NBP1-70668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAOX Antibody (NBP1-70668)

Discover more about diseases related to PAOX Antibody (NBP1-70668).

Pathways for PAOX Antibody (NBP1-70668)

View related products by pathway.

Blogs on PAOX

There are no specific blogs for PAOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAOX Antibody and receive a gift card or discount.


Gene Symbol PAOX